(data stored in ACNUC1104 zone)

EMBL: AM420293.CYPA

AM420293.CYPA        Location/Qualifiers
FT   CDS_pept        complement(264665..265870)
FT                   /transl_table=11
FT                   /gene="cypA"
FT                   /locus_tag="SACE_0229"
FT                   /product="cytochrome P450-like enzyme"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99581"
FT                   /db_xref="GOA:A4F6A7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A7"
FT                   /protein_id="CAL99581.1"
FT                   /translation="MSIPADTWGIPASQFWLRGRRPERTVDYDAATGMWNVYGYPEIQH
FT                   VLSDPRTFSSDTTRLMPAKVAERTSALSEGSLLQMDPPEHTKLRKLVSHAFTPKVVADL
FT                   APRIADLANELLDDVGDRMEMVEDLAYPLPVIVIAELLGVPGSDRHLFKKWVDALLQRD
FT                   QQFSLVDESDEQVQQVEEAIAQVKHLTDYLGEHAAERRRAPREDLLTKLVQAEVDGHRL
FT                   SDTEVVNFANILLLAGHITTTMLLGNTVLCLDTHPRQRDAVRADRSLVPSAIEESLRFF
FT                   SPFAVLGRVTQREVEVGGQTIPQDQMLMLWIAAANRDPRQFADPDVFDVTRDPNPQIAF
FT                   GRGIHFCVGAPLARLEGKVALNILLDRFPHLRTDPDEGPTFLPAPTTTGVRKLPLLLTP
FT                   SA"
     atgtccatcc ccgccgacac ctggggcatc cccgcgtcgc agttctggct gcgcggccgg        60
     cgtcccgagc ggaccgtcga ctacgacgcc gcgaccggca tgtggaacgt ctacgggtac       120
     ccggagatcc agcacgtcct cagcgatccg cgcaccttct cgtcggacac cacgcggctc       180
     atgcccgcca aggtcgccga acgcacctcg gcgctctccg agggcagcct gctgcagatg       240
     gacccgccgg agcacaccaa gctccgcaag ctggtcagcc acgccttcac cccgaaggtg       300
     gtggccgacc tcgcgccgcg catcgccgac ctggccaacg agctgctcga cgacgtcggc       360
     gaccggatgg agatggtcga ggacctggcc tacccgttac ccgtgatcgt catcgccgag       420
     ctgctgggag tgcccggcag cgaccgccac ctgttcaaga agtgggtcga cgccctgctg       480
     caacgcgacc agcagttctc cctcgtcgac gagagcgacg agcaggtcca gcaggttgag       540
     gaggcgatcg cccaggtcaa gcacctgacc gactacctgg gcgagcacgc ggccgagcgg       600
     cggcgggcgc cgcgtgagga cctgctgacc aagctcgtgc aggccgaggt cgacggccac       660
     cggctcagcg acaccgaggt cgtcaacttc gccaacatcc tgctgctcgc cgggcacatc       720
     accacgacca tgctgctggg caacacggtg ctctgcctgg acacgcaccc gcggcagcgc       780
     gacgcggtcc gcgccgaccg gtcgctcgtg ccgtcggcga tcgaggagtc gctgcggttc       840
     ttcagcccgt tcgccgtgct cggcagggtc acccagcgcg aggtcgaggt gggtgggcag       900
     accatcccgc aggaccagat gctgatgctg tggatcgccg cggccaaccg cgacccccgg       960
     cagttcgccg atcccgacgt cttcgacgtc acccgcgacc cgaacccgca gatcgccttc      1020
     gggcgcggca tccacttctg cgtcggggcg ccgctggccc ggctggaggg caaggtcgcg      1080
     ctgaacatcc tgctggaccg gttcccgcac ctgcgcaccg atccggacga ggggcccacg      1140
     ttcctgcccg cgccgaccac caccggcgtg cggaagctgc cgttgctgct cacccccagc      1200
     gcctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page