(data stored in ACNUC1104 zone)

EMBL: AM420293.DNAA

AM420293.DNAA        Location/Qualifiers
FT   CDS_pept        1..1779
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SACE_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99356"
FT                   /db_xref="GOA:A4F5N2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N2"
FT                   /protein_id="CAL99356.1"
FT                   /translation="MADHQADLGRVWEEVVQELSSGTLSPQQRAWMRVTRPIGLLDGTA
FT                   LLAAPSDFAKEAIERALREPITDALSRRLGRDVSLAVKVDTAVQAPSRPAPPPAESWPT
FT                   RDSITGPDRPTGFAEAGVSPYISTSSSYLQPPRTDSFTPPVTGSLPAVDNHYPTAEQPR
FT                   VVDYQSADYPTTEYHDWPTAAELTAGTPHEGESEAAPESDDEVDEEREAIDAANEIWPT
FT                   FGRGQAPEAQQGQPFTAPKHAPPTSQTRLNAKYTFDTFVIGASNRFAHAAAVAAAEAPA
FT                   RAYNPLFIWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEFTNDFINSLRDDRQVA
FT                   FQRRYRDVDVLLVDDIQFLEGKEGTQEEFFHTFNTLHNSNKQIVVSSDRPPKGLRTLED
FT                   RLRTRFEWGLITDIQPPELETRIAILRKKAAQDRMNAPADVLEFIAARIERNIRELEGA
FT                   LIRVTAFASLNRQPVDVQLAEIVLRDLIPDSQTPEITAPTIMAVTADFFSVTIDDLCGP
FT                   GKTKALAQARQIAMYLCRELTDSSLPKIGQSFGGRDHTTVMHADKKIRKEMAERRRVYD
FT                   QVQELTSRIKQQSRGS"
     gtggccgacc accaggcgga tcttggccgg gtctgggaag aggtggtgca ggagctgtcc        60
     tccggcacgc tctcacccca gcagcgcgcg tggatgcgcg tgacgcgccc catcggcctg       120
     ctggacggga cggcactgct ggccgcgccc agcgacttcg cgaaggaagc catcgaacgc       180
     gccctgcgcg aacccatcac cgacgcgctc tcgcgccgcc tcggccgcga cgtctcgctc       240
     gccgtgaagg tcgacaccgc ggtccaggcc ccgagcaggc cggccccgcc acccgctgag       300
     tcgtggccca cccgggacag catcaccgga ccggaccgcc cgaccggctt cgccgaggcc       360
     ggcgtctcgc cctacatctc gacctcttcc tcctacctgc agccgccgcg aacggactcc       420
     ttcaccccgc cggtcaccgg ctcgctgccc gccgtggaca accactaccc gacggccgag       480
     cagccgcggg tggtcgacta ccagagcgcg gactacccga cgacggagta ccacgactgg       540
     cccaccgcgg ccgagctgac ggcggggacg ccgcacgagg gcgagtccga ggcggcgccg       600
     gagtccgacg acgaggtgga cgaggagcgc gaggcgatcg acgcggccaa cgagatctgg       660
     ccgacgttcg ggcgcggcca ggcgcccgag gcccagcagg gccagccgtt caccgcgccc       720
     aagcacgccc cgccgacctc gcagaccagg ctgaacgcga agtacacctt cgacaccttc       780
     gtcatcggcg cgtcgaaccg cttcgcgcac gccgcggcgg tggccgcggc cgaggcgccg       840
     gcccgcgcgt acaacccgct gttcatctgg ggtgagtccg ggctcggcaa gacgcacctg       900
     ctgcacgccg tcgggcacta cgcgcaacgg ctcttcccgg ggatgcgggt ccgctacgtg       960
     tccaccgagg agttcaccaa cgacttcatc aactcgctgc gcgacgaccg ccaggtcgcc      1020
     ttccagcgcc gctaccgcga cgtggacgtg ctgctggtcg acgacatcca gttcctggag      1080
     ggcaaggaag gcacccagga ggagttcttc cacaccttca acacgctgca caactcgaac      1140
     aagcagatcg tggtgtcctc cgaccgcccg cccaaggggc tgcggacgct ggaggaccgg      1200
     ctgcgcacca ggttcgagtg gggtctgatc accgacatcc agccgccgga gctggagacc      1260
     cggatcgcga tcctgcgcaa gaaggcggcc caggaccgga tgaacgcgcc cgccgacgtg      1320
     ctggagttca tcgcggcgcg catcgagcgc aacatccgcg agctggaggg cgcgctgatc      1380
     cgggtcaccg cgttcgcctc gctgaaccgg cagccggtgg acgtgcagct cgccgagatc      1440
     gtgctgcgcg acctgatccc ggactcccag acgccggaga tcaccgcgcc gacgatcatg      1500
     gcggtgaccg ccgacttctt cagcgtcacc atcgacgacc tgtgcggccc gggcaagacc      1560
     aaggcgctgg cgcaggcccg ccagatcgcg atgtacctgt gccgcgagct gaccgactcg      1620
     tcgctgccga agatcggcca gagcttcggc ggccgcgacc acaccacggt catgcacgcc      1680
     gacaagaaga tccgcaagga gatggccgag cgcaggcggg tctacgacca ggtgcaggag      1740
     ctgacctccc gcatcaagca gcagtcgcgc ggctcctga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page