(data stored in SCRATCH zone)

EMBL: AM420293.DNAK

AM420293.DNAK        Location/Qualifiers
FT   CDS_pept        complement(326975..328237)
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SACE_0293"
FT                   /product="chaperone protein HscC"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99642"
FT                   /db_xref="GOA:A4F6G8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G8"
FT                   /protein_id="CAL99642.1"
FT                   /translation="MLCRAQDGSYLAGEQAQRQELTHHQWVARGFTRRVGEDAPLLVGN
FT                   DFVQPHALAATMIEWVADAVAHRQGHPPEHIAVAHSANWGPHRTHVVHQALAQLGISDV
FT                   TLLPEPVAVAMDYASKQRVDDGGAIAVGNIGGTGFDATVLRRRTPGFEVVGPPLDSPHP
FT                   GGQDLDDALFEHIRAELGGLAGLDVTDFNVRATLAQLRGDCVHARETLSFHPGATLRIH
FT                   LPKVNTDFAVSRSRFEKLARTHLERVPELVLQAVQSANLTPGELDAVVLAGGVARTPLL
FT                   KQLVQERLERQPLVDGAPELVAACGAAVSAVKAVSTEGDQAASMAETSVLMRIEAPDDD
FT                   PNLLDPLDDDVAESPRPPVEVEPMHIEPPDEKRQRLFKILKLTLAALLVIAGLIMTFYG
FT                   TPSTGGLLGGAGGPAPQQQQR"
     gtgctctgcc gggcgcagga cggctcgtac ctggcaggcg agcaggcgca gcgccaggag        60
     ctcacccacc accagtgggt ggcccgcggc ttcacccgtc gggtgggcga ggacgcgccg       120
     ctgctggtcg gcaacgactt cgtccagccg cacgcacttg ccgcgaccat gatcgagtgg       180
     gtggccgacg ccgtcgcgca ccgccagggc catccccccg agcacatcgc cgtcgcccac       240
     agcgcgaact ggggaccgca ccggacccac gtcgtgcacc aggcgctggc ccagctcggc       300
     atcagcgacg tgacgctgct gcccgagccg gtggcggtgg ccatggacta cgcgagcaag       360
     cagcgcgtcg acgacggagg cgctatcgcc gtcggcaaca tcggcggcac cggcttcgac       420
     gcgaccgtgc tgcgcaggcg cacccccggc ttcgaggtcg tcgggccgcc gctggactcc       480
     ccccacccgg gcggccagga cctcgacgac gcgctcttcg agcacatccg cgccgagctg       540
     ggcggcctcg ccgggctcga cgtcaccgac ttcaacgtcc gcgccacgct cgcgcagctg       600
     cgcggcgact gcgtccacgc ccgggagacg ctgtcgttcc acccaggggc gacgctgcgc       660
     atccacctgc cgaaggtcaa caccgacttc gcggtctcgc gctcgcgctt cgagaagctg       720
     gccaggacgc acctggagcg ggtgcccgaa ctggtcctgc aggcggtgca gtcggccaac       780
     ctcaccccgg gcgagctcga cgcggtcgtc ctcgccggcg gcgtcgcgcg aacgccgctg       840
     ctgaagcagc tcgtccagga gcggctggag cgccaaccgc tggtcgacgg cgcacccgag       900
     ctggtcgcgg cgtgcggcgc ggccgtctcc gccgtgaagg cggtgtcgac cgagggcgac       960
     caggccgcgt cgatggccga gaccagcgtg ctgatgcgga tcgaggctcc cgacgacgac      1020
     ccgaacctgc tcgacccgct cgacgacgac gtcgccgaaa gcccccgccc gccggtggag      1080
     gtggagccga tgcacatcga gcccccggac gagaagcggc agcggctctt caagatcctc      1140
     aagttgacat tggccgcgct gctggtcatc gcggggttga tcatgacctt ctacggcacg      1200
     ccgagcaccg gcggcctgct cggcggcgcg ggcggccccg caccccagca acagcagcgg      1260
     tag                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page