(data stored in ACNUC1104 zone)

EMBL: AM420293.EMBC

AM420293.EMBC        Location/Qualifiers
FT   CDS_pept        205651..208779
FT                   /transl_table=11
FT                   /gene="embC"
FT                   /locus_tag="SACE_0178"
FT                   /product="probable arabinosyltransferase, membrane protein"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99530"
FT                   /db_xref="GOA:A4F656"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F656"
FT                   /protein_id="CAL99530.1"
FT                   /translation="MNHPIGSAVLERPAEPGPERPERRSAPLWLAHFVALTVGLLGLVC
FT                   ALSLPFAPVWSDRTEVRWPSVHAGTPDAPGTGTTLDDGLRSTTALFAPYRPAEFHAAVP
FT                   CATLRSADGTVFSTLPPGSDREGMVLAVREGEPRLLLGQREVELPPLAGDCTLNVNADS
FT                   AQSVVTVGASTTRLPGVAAPEIFTFSTDLEPVQAATLSVTARTFSWFDTTPTEQKRGMV
FT                   TGALLMAALSLLFLVVTAPPAMSALRGAARLRTWLLLPVDAAVLGILAWWLVIGPISDD
FT                   DGFAMMTVRNFEPTGDIGNYYRWFNASETPFTLVQHTMRWFADHSLAPVWLRLPSVLAG
FT                   ALTWVVLSRGVVGPLCGPGSRLRAHLLAAVFFLACWLPFDLGVRPEAFVALGTTVLVAA
FT                   LLKAEHSAGPFAWLGLAAVAAGLTVAVTPTGVAALVIVLVFSPRIGRLVVRPGAVPAWL
FT                   AIPARIALVGCAGSVGLVAMFADSTWNGVAQATWLHDEFGPSLGWYQEFNRYNVLLGTT
FT                   HWGAAGKRLAVFLVVTAALIAAGCVLRGLHRSTRTPDVALLLGAVAAIFAALWLTPSKW
FT                   THHFGSLAGLGPALLAVTVVMLTRVRAPREARVLGVCGASAASLAAGLAFMGPNAWYLY
FT                   SDIAMPWSDAPVDPLDQPVLWLAVGVASGLVAYAVVLLSRRGEAEARQAWTTMPSSVLA
FT                   LAALASTIVLLGSFTTAYRETGDRFSVARTNWHSVTATSCGVEDEVETLPLAATLRALP
FT                   GAPEPDGFALSGSPPPEPDLDPESRKDGEVQPQEDVPPVWDSREGGPQNTGTLTTGWFE
FT                   LPALEPDQVLAIWVAGRPEQGNSLAVEFGTPIGDVVRELRDPPPTELPFDDPRHGRPVD
FT                   WRDFRPWRVMTVEAPAGARTVRLHAEDRTTDEQGWLAVSAPVVRDVVPLPEVLDAQGPT
FT                   LVDWPMGLLFPCRIDYPRVSGGTADSPGVLVAPPAGEASMAYAPDLGGVFAGVPMQSRR
FT                   IELPSRLRGAPGVRWGHVYAVSYDTERDVYDRHVTRIRIGGADGDGAYPFEEH"
     gtgaaccacc cgatcggttc ggccgtactc gaacgtcccg ccgagcccgg cccggagcga        60
     ccggagcgca ggagcgctcc gctgtggctc gctcacttcg tcgcgctcac ggtcggtttg       120
     ctggggctgg tctgcgcttt gtctttgccg ttcgcgccgg tgtggtccga ccgcaccgag       180
     gtgcggtggc cgtccgtgca cgccggtacg ccggacgcgc ccggcaccgg cacgacgctc       240
     gacgacgggc tgcggtcgac cacggcgctg ttcgcgccct accgcccagc cgagttccac       300
     gcggcggtgc cgtgcgcgac gctgcggagc gcggacggaa cggtgttctc gacgctgccg       360
     ccgggcagcg accgcgaagg catggtcctc gcggtccgcg aaggtgagcc gcggctcctg       420
     ctcgggcagc gggaggtgga gctcccaccg ctcgccggcg actgcacgct caacgtgaac       480
     gccgactccg cgcagtccgt ggtcaccgtc ggcgcctcca ccacgaggct gcccggtgtc       540
     gcggcgccgg agatcttcac cttcagcacc gatctcgaac ctgtgcaggc cgccacgctc       600
     tcggtcaccg cgcgcacgtt ctcgtggttc gacaccacac cgaccgagca gaagcgcggc       660
     atggtcaccg gcgcgctgct gatggccgct ctctcactgc tgttcctggt ggtgaccgca       720
     ccgccggcga tgtcggcgct gcgcggggcc gcgcggctca ggacctggct gctgctgccg       780
     gtcgacgccg ccgtgctcgg gatcctcgct tggtggctgg tcatcggccc gatcagcgac       840
     gacgacggct tcgcgatgat gaccgtccgc aacttcgaac cgaccggcga catcggcaac       900
     tactaccgct ggttcaacgc gtcggagaca ccgttcacgc tggtgcagca cacgatgcgg       960
     tggttcgccg accacagcct cgcgccggtc tggctgcggc tgccgagcgt gctggcgggc      1020
     gcgctcacct gggtcgtgct cagcaggggc gtcgtcggcc cgctgtgcgg accgggctcg      1080
     cggctgcggg cgcacctgct cgccgcggtg ttcttcctgg cctgttggct cccattcgac      1140
     ctcggcgtgc gtcccgaggc gttcgtcgcg ctgggcacca ccgtgctggt cgcggcactg      1200
     ctgaaggccg agcactccgc gggccccttc gcttggctcg gcctggccgc ggtggccgcc      1260
     ggcctgaccg tcgcggtgac accgaccggc gtcgcggcgc tggtcatcgt gctcgtgttc      1320
     tcgccgcgca tcgggcggtt ggtcgtgcgg ccgggagcgg taccggcgtg gctggcgatt      1380
     cccgcgcgca tcgcactggt cgggtgcgcc ggatcggtcg gcctggtcgc gatgttcgcc      1440
     gactcgacgt ggaacggcgt ggcgcaggcg acctggctgc acgacgagtt cggcccgagc      1500
     ctgggctggt accaggagtt caaccgctac aacgtgctgc tcggcacgac gcactggggc      1560
     gcggcgggca agcggctcgc ggtcttcctg gtggtcaccg cggcgctgat cgcggcgggc      1620
     tgcgtgctgc gcgggctgca ccgctcgacg cggacgcccg acgtcgcgct gctgctcggt      1680
     gcggtggccg cgatcttcgc cgcgctgtgg ctgacgccgt cgaagtggac ccaccacttc      1740
     ggctcgctcg ccggcctcgg tcctgctctg ctggcggtga ccgtcgtgat gctgacgcgg      1800
     gtgcgcgcgc cgcgggaggc gcgggtgctg ggcgtctgcg gtgcgtcggc ggcgtcgctg      1860
     gcggccggat tggcgttcat ggggcccaat gcctggtacc tgtactccga catcgcgatg      1920
     ccgtggtcgg acgcaccggt cgatccgctg gaccagccgg tgctgtggct cgcggtgggc      1980
     gtggcgtccg gtctggtcgc ctacgccgtc gtgctcctgt cgcggcgcgg ggaggccgag      2040
     gcacggcagg cgtggaccac catgccgtcg tcggtgctgg cgttggcggc gctggcctcg      2100
     acgatcgtgc tgctcggctc gttcacgacc gcataccggg agacgggcga ccgattctcg      2160
     gtcgcgcgca ccaactggca cagcgtcacc gccacgagct gcggtgtcga ggacgaggtc      2220
     gagacgctcc cgctggccgc gaccctgcgg gcgttgccgg gcgcaccgga accggacggc      2280
     ttcgcccttt ccgggtcgcc gccgcccgag cccgacctgg acccggagtc caggaaggac      2340
     ggcgaagtcc agccgcagga ggacgtgccg ccggtgtggg acagccgcga aggcggaccg      2400
     cagaacacgg gcaccctgac caccgggtgg ttcgagctgc ccgcgctgga gcccgaccag      2460
     gtgctcgcga tctgggtcgc gggccggccg gagcagggca actcgctcgc cgtcgagttc      2520
     ggcacgccga tcggcgacgt ggtccgggag ctgcgcgacc cgccaccgac cgaactgccc      2580
     ttcgacgacc cccgccacgg caggccggtc gactggcgcg acttccgccc gtggcgcgtg      2640
     atgaccgtcg aggcccccgc cggtgcccgc accgtgcggc tgcacgccga ggaccggacg      2700
     accgacgagc agggctggct ggcggtcagc gccccggtgg tccgcgacgt cgtgccgttg      2760
     cccgaggtgc tcgacgcgca ggggccgacg ctggtcgact ggccgatggg gctgctcttc      2820
     ccgtgccgca tcgactaccc gcgcgtcagc ggcggcaccg ccgacagccc cggcgtgctg      2880
     gtcgcaccgc ccgccggtga ggcgtcgatg gcgtacgccc ccgacctcgg cggggtcttc      2940
     gccggggtgc cgatgcagtc gcgccggatc gaactgccga gcaggctgcg cggcgccccc      3000
     ggcgtccggt ggggccacgt ctacgccgtc agctacgaca ccgagcgcga cgtctacgac      3060
     cggcacgtga cgaggatccg gatcggcggt gcggacggcg acggcgccta ccccttcgaa      3120
     gagcactga                                                              3129
//

If you have problems or comments...

PBIL Back to PBIL home page