(data stored in ACNUC1104 zone)

EMBL: AM420293.FEPD

AM420293.FEPD        Location/Qualifiers
FT   CDS_pept        460677..461747
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="SACE_0411"
FT                   /product="putative ferrichrome transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99759"
FT                   /db_xref="GOA:A4F6T5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T5"
FT                   /protein_id="CAL99759.1"
FT                   /translation="MSRSAIVGDPPEAAREPAAGGRLAARRRRRLVGIGVLAVLLLLSC
FT                   LLSVLLGAKPMSLEAVWSALFAPTGTENDLIVRELRVPRTIVGVLAGVALGLAGALMQG
FT                   HTRNPIADPGILGITHGAALGIVLSVYVFGITSLFGFIWFGFGGALLGALAVFAIGSIG
FT                   RGGPTPVTLALAGMAIGYLLQAITSALVLVDQQSLETYRFWKVGSIAVTDTSVIWQVLP
FT                   FLAVGVVVALANASGLNALSLGEDVARSLGHRVQWSRRLGIAAIAVLVGGAVAICGPIG
FT                   FVGLIVPHVARFFTGADYRWLLPFAALMGASVVLLADVLGRLVARPAEIQVGVMLAVVG
FT                   APFFIGLVRRRKLVRL"
     gtgagtcgca gcgcgatcgt gggcgacccg cccgaggccg cacgcgagcc cgctgcgggc        60
     gggcggctgg cggcccgccg ccgcaggcgg ctggtcggca tcggagtgct cgccgtgctc       120
     ctgctgctga gctgcctgct cagcgtgttg ctcggtgcca agcccatgtc cctcgaagcg       180
     gtctggagcg cgctgttcgc gcccaccggt accgagaacg acctgatcgt ccgcgagttg       240
     cgggtgccgc gcacgatcgt cggagtgctg gccggggtcg cgctcgggct cgcgggcgcg       300
     ctcatgcagg gccacacccg caaccccatc gccgaccccg gcatcctcgg catcacccac       360
     ggcgcggcgc tgggcatcgt gctctcggtc tacgtcttcg gcatcaccag cctgttcggc       420
     ttcatctggt tcggcttcgg cggcgcgctg ctgggcgcgc tcgcggtgtt cgccatcggt       480
     tccatcggcc gcggcggacc gacaccggtc acgctcgcgc tggccggcat ggccatcggc       540
     tacctgctgc aggccatcac ctcggcgctg gtgctggtcg accagcagag cctggagacc       600
     taccggttct ggaaggtcgg ctcgatcgcg gtcaccgaca cctcggtgat ttggcaggtg       660
     ctgccgttcc tggcggtcgg ggtggtggtc gcgctggcca acgcctccgg cctcaacgcg       720
     ctctcgctcg gcgaggacgt cgcccgctcg ctcggccacc gcgtgcagtg gtcccggcgg       780
     ctgggcatcg cggccatcgc ggtactggtc ggcggcgcgg tcgccatctg cgggccgatc       840
     ggcttcgtcg gcctgatcgt gccgcacgtg gcccgcttct tcaccggcgc cgactaccgc       900
     tggctgctgc ccttcgcggc gctgatgggc gcgtcggtgg tgctgctggc cgacgtgctc       960
     gggcggctgg tcgcccggcc cgccgagatt caggtgggcg tgatgctcgc ggtcgtcggc      1020
     gcccccttct tcatcggact ggtgcggcgc aggaagttgg tgcggttgtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page