(data stored in ACNUC1104 zone)

EMBL: AM420293.FEPG

AM420293.FEPG        Location/Qualifiers
FT   CDS_pept        461744..462829
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="SACE_0412"
FT                   /product="Fe(3+) enterobactin transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99760"
FT                   /db_xref="GOA:A4F6T6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T6"
FT                   /protein_id="CAL99760.1"
FT                   /translation="MTRTVQAPKVAGRRSVRVGPVSGVLRLRPALVLLAGLVLLLLLFV
FT                   LNVGLGEYQISPAEVLTTLVGGGDRAEQVIIWELRMPRSLTGLLVGAALGAAGAIMQAI
FT                   ARNPLASPDMLGITWGAGTAATAVIVLGGSVGTVTGALESVGLPLVALAGGLLVGLAVY
FT                   VLSYRNGVDSYRLVLVGVGMSALAGNATYWLLSVGDVNDAGRAMVWLTGSLNARGWEHV
FT                   VPVAIVLALLVPLTLVGAHVLGALQFDDDTVRGLGIRMDAARGGLLIAAVLLAAVATAA
FT                   AGPIQFVALAVPQIALRLARTAMPPLLTSMVLGAALVVGSDLISRTAFGGIEMPVGIVT
FT                   SVLGAPYLIYLLVRRYREVRA"
     gtgacccgga ctgtgcaggc gccgaaggtc gcgggccgca ggtccgtgcg ggtgggcccg        60
     gtctccggtg tgctgcggtt gcgcccggca ctggtcctgc tggcagggct ggtgctgctc       120
     ctgctgctct tcgtgctcaa cgtcgggctg ggggagtacc agatcagccc ggccgaggtg       180
     ctcaccacgc tggtcggcgg cggcgaccgg gcggagcagg tgatcatctg ggagctgcgg       240
     atgccgcgct cgctgaccgg actgctggtg ggcgccgcgc tcggagccgc gggcgcgatc       300
     atgcaggcca tcgcccgcaa cccgctggcc agcccggaca tgctcggcat cacctggggc       360
     gcgggtaccg cggccaccgc ggtgatcgtg ctcggcggca gcgtcggcac cgtcaccggc       420
     gcgctggagt cggtcgggct gccgctggtg gcgctggcgg gcgggctcct cgtgggcctg       480
     gcggtgtacg tgctgtccta ccgcaacggc gtcgactcct accgcctcgt gctcgtcggt       540
     gtgggcatga gcgccctggc gggcaacgcg acctactggc tgctgtcggt cggcgacgtc       600
     aacgacgcgg gccgcgcgat ggtgtggctg accggcagcc tcaacgcgcg cggctgggag       660
     cacgtcgtcc cggtggccat cgtgcttgcc ctgctggtgc cgttgacgct ggtcggggcg       720
     cacgtgctgg gcgcgctgca gttcgacgac gacaccgtgc gcggcctggg catccggatg       780
     gacgccgccc gcggcgggct gctgatcgcc gccgtcctgc tggccgcggt ggcgaccgcg       840
     gcggccggcc cgatccagtt cgtcgcgctg gcggtgccgc agatcgcgct ccggctggcc       900
     cgcaccgcga tgccgccgct gctgacgtcg atggtgctcg gcgccgcgct cgtcgtcgga       960
     tcggacctaa tctcgcgcac cgccttcggc ggcatcgaga tgcccgtcgg catcgtcacc      1020
     tcggtgctcg gcgcccccta cctgatctac ctgctcgtcc gtcggtaccg ggaggtccgc      1080
     gcatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page