(data stored in SCRATCH zone)

EMBL: AM420293.FHUC

AM420293.FHUC        Location/Qualifiers
FT   CDS_pept        complement(504032..504901)
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SACE_0452"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99800"
FT                   /db_xref="GOA:A4F6X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X6"
FT                   /protein_id="CAL99800.1"
FT                   /translation="MTAKPEAGHSGHDSTAVADRAPSRAPAVQLRGAQLSYGTRVLWDG
FT                   LDLDVEPGEFLAVLGPNGSGKTSLLRVLLGLQPLSSGSVKVAGAPAHRGSARIGYIPQQ
FT                   RAVDATLTVRGRDLVGFGLDGHHWGMGIRQRRERRRRVDDALRAVDATAYAKMPLGLLS
FT                   GGEQQRLRVAQALVSDPAVLLCDEPLLSLDIAHQRKVSRLISQQARDAGAAVLFVTHEL
FT                   NPVLPLVDRVLYLVGGRFRIGTPDEVMNSETLSELYGTRIEVARVGGRLVVSGVDEEGC
FT                   HVHEAEQA"
     atgaccgcca aacccgaagc cgggcactcc ggccacgaca gcaccgcggt ggccgaccgc        60
     gcaccgagcc gcgcccccgc cgtccagttg cgcggtgcgc agctctccta cggcacgcgc       120
     gtgctctggg acggcctgga cctcgacgtc gagccgggcg agttcctggc ggtgctgggc       180
     cccaacggct ccggcaagac gagcctgctg cgggtcctgc tcggcctcca gccgctgagc       240
     tccggctccg tgaaggtcgc cggagcgccc gcgcaccggg gcagcgccag gatcggctac       300
     atcccgcagc agcgggcggt ggacgcgacc ctcacggtcc gcggccggga cctggtgggc       360
     ttcgggctcg acggccacca ctggggcatg ggcatccggc agcgccgcga gcgtaggcgg       420
     cgggtcgacg acgcgctgcg cgcggtcgac gccaccgcct acgccaagat gccgctcggc       480
     ctgctctccg gcggggagca gcagcggctg cgggtggcgc aggccctggt gagcgacccg       540
     gcggtgctgc tgtgcgacga gccgctgctc tcgctcgaca tcgcccacca gcgcaaggtc       600
     agcaggctca tctcccagca ggccagggac gccggggcgg cggtcctgtt cgtcacccac       660
     gagctgaacc cggtgctgcc gctggtcgac cgggtcctct acctggtcgg cgggcgtttc       720
     cggatcggca ccccggacga ggtcatgaac tccgagacgc tctccgagct ctacggaacc       780
     aggatcgagg tggccagggt cggcggcagg ctggtcgtca gcggcgtcga cgaggaaggc       840
     tgccacgtgc acgaggcgga acaggcgtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page