(data stored in ACNUC1104 zone)

EMBL: AM420293.FTSH

AM420293.FTSH        Location/Qualifiers
FT   CDS_pept        444999..447386
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SACE_0396"
FT                   /product="putative cell division protein"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99744"
FT                   /db_xref="GOA:A4F6S0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S0"
FT                   /protein_id="CAL99744.1"
FT                   /translation="MTAFLLIYAFSVLFDETRNYREVSTSQALEQIAQGKVKEATIEDK
FT                   EQRVRLTLKDGQTFENSSELIAQYPAGATDQVVQEIRNGQVPSWNTKVTQDSFWVQMLF
FT                   YLVPIGLLVLLLMWMMNNVQGGGNRVLNFGKSKAKQLTKDMPKTLFGDVAGADEAVEEL
FT                   HEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFYSISGSDFVE
FT                   MFVGVGASRVRDLFEQAKQNAPCIVFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEM
FT                   DGFDSRGGIILIAATNRPDILDPALLRPGRFDRQIPVSAPDLRGRRAILGVHSKGKPLA
FT                   QDADLDGLAKRTVGFSGADLENVVNEAALLTARENGQLITAAALEESVDRVIGGPRRKS
FT                   KIISERDKKITAYHEGGHALAAWAMPDLEPVYKLTILPRGRTGGHALVVPEDDKDMMTR
FT                   SEMIARLVFALGGRSAEELVFHEPTTGASSDIEQATKIARAMVTEYGMTARLGAVKYGK
FT                   EEGDPFLGRSAGQQPNYSLEVAHEIDEEVRKLIEAAHTEAWEILNTYRDVLDELVLELI
FT                   EKETLVRKDLERIFTKVEKRPRITAFNDFGGRTPSEKPPIKTPGELARERGEPWPPVTE
FT                   QPPAPAPTPVGAGQQQGDASQSNGVGQYGQHPGTVQFPNPGHQQGQQGGYQQPGQGQYG
FT                   QPVPQAVPPNYGAPPGWTPATSPSGSAPSGAPVPSGAEQGGNQYNWVPSWERSQQPQTG
FT                   PSQPGGGDSNGTPGAQPAQGEGQSGQSPDSTDENGNGTSTNR"
     ttgacggcgt ttctgctgat ctatgccttc agcgtgctct tcgacgagac tcgcaactac        60
     cgcgaagtct caacctcgca ggctttggag cagatcgctc agggcaaggt caaggaagcg       120
     accatcgagg acaaggagca gcgggttcgt ctgaccctca aggacggcca gaccttcgag       180
     aacagctccg agctgatcgc ccagtacccc gccggtgcca ccgaccaggt ggtgcaggag       240
     atccgcaacg gccaggtgcc gagctggaac accaaggtca cccaggactc gttctgggtg       300
     cagatgctgt tctacctcgt gcccatcggc ctgctggtgc tgctgctgat gtggatgatg       360
     aacaacgtcc agggcggcgg caaccgcgtg ctcaacttcg gcaagtccaa ggccaagcag       420
     ctcaccaagg acatgcccaa gacgttgttc ggcgacgtcg ccggtgccga cgaggccgtt       480
     gaggaactcc acgagatcaa ggacttcctg cagaacccgg gtcgctacca ggccctcggc       540
     gccaagattc ccaagggcgt gctgctctac ggtccaccgg gcaccggcaa gacgctgctc       600
     gcgcgcgcgg tggccggcga ggccggggtg ccgttctact cgatctcggg ttccgacttc       660
     gtcgagatgt tcgtcggtgt cggtgcttcc cgggtccgcg acctgttcga gcaggccaag       720
     cagaacgccc cctgcatcgt cttcgtcgac gagatcgacg cggtcggccg ccagcgcggc       780
     gccggcctcg gcggcggtca cgacgagcgc gagcagacgc tgaaccagct cctggtcgag       840
     atggacggct tcgactcgcg cgggggcatc atcctcatcg ccgcgaccaa ccgcccggac       900
     atcctcgacc ccgcgctgct gcgtccgggc cgcttcgacc gccagatccc ggtgtccgcg       960
     ccggacctgc gcggccgccg cgcgatcctc ggcgtgcact ccaagggcaa gccgctggcg      1020
     caggacgccg acctcgacgg cctggccaag cgcaccgtcg gcttctccgg cgccgacctg      1080
     gagaacgtgg tcaacgaggc cgcgctgctc accgcgcggg agaacggcca gctcatcacg      1140
     gccgccgcgc tggaggagtc ggtcgaccgg gtgatcggcg gtccccgccg caagagcaag      1200
     atcatctcgg agcgggacaa gaagatcacc gcctaccacg agggcgggca cgcgctggcc      1260
     gcgtgggcca tgcccgacct ggagccggtc tacaagctca cgatcctgcc gcgcggccgc      1320
     accggcggtc acgcccttgt cgtccccgag gacgacaagg acatgatgac ccggtcggag      1380
     atgatcgccc ggctggtgtt cgccctcggc gggcgctcgg cggaggagct ggtgttccac      1440
     gagcccacca ccggtgcctc cagcgacatc gagcaggcca ccaagatcgc gcgcgccatg      1500
     gtcaccgagt acggcatgac cgcccggctg ggcgcggtga agtacggcaa ggaggagggc      1560
     gacccgttcc tgggccgctc ggccggccag cagccgaact actcgctcga ggtcgcccac      1620
     gagatcgacg aggaggtgcg caagctcatc gaggcggcgc acaccgaggc gtgggagatc      1680
     ctcaacacct accgcgacgt gctcgacgag ctcgtcctcg agctgatcga gaaggagacg      1740
     ctggtccgca aggacctgga gcgcatcttc accaaggtcg agaagcggcc gcggatcacc      1800
     gcgttcaacg acttcggcgg tcgcaccccg tcggagaagc ccccgatcaa gaccccgggc      1860
     gagctggcca gggagcgcgg cgagccgtgg cccccggtca ccgagcagcc gcctgccccg      1920
     gcgcccactc cggtcggtgc gggccagcag cagggcgacg cgtcgcagag caacggcgtg      1980
     ggccagtacg gccagcaccc gggcaccgtg cagttcccga acccggggca ccagcagggc      2040
     cagcagggcg gctaccagca gcccggccag ggtcagtacg gccagccggt cccgcaggcg      2100
     gtgccgccca actatggtgc cccgcccggg tggaccccgg cgacctcgcc ttcgggctcg      2160
     gccccctcgg gtgcgcccgt gccctcgggt gccgagcagg gtggcaacca gtacaactgg      2220
     gtgccgtcct gggagcggag ccagcagccg cagaccgggc cgtcgcagcc cggcggcggc      2280
     gactccaacg ggacgcccgg cgcgcagccc gcgcagggcg aggggcagtc cgggcagagc      2340
     ccggactcca ccgacgagaa cgggaacggc accagcacca accggtga                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page