(data stored in SCRATCH zone)

EMBL: AM420293.FTSW2

AM420293.FTSW2       Location/Qualifiers
FT   CDS_pept        complement(64180..65616)
FT                   /transl_table=11
FT                   /gene="ftsW2"
FT                   /locus_tag="SACE_0047"
FT                   /product="putative cell division protein"
FT                   /function="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99400"
FT                   /db_xref="GOA:A4F5S6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S6"
FT                   /protein_id="CAL99400.1"
FT                   /translation="MSQPAAAAGTQTPSGHTPEPGVPTRRGTELFLLICSAVIITVAIM
FT                   LVQISREQTISRELFYYGAAFLALFGAAHFAVRRWAPYADPLILPLVSLINGLGLVVLH
FT                   RLDFEEVTGSPFTGKQIMFATVGVVLFILVLALVKDHRTLARYSFTCGFVGLALLALPG
FT                   LLPSSISEVNGAKLWINIGGQSIQPGEFAKLLLLIFFASFLVSKRELFTTAGRRFLGVD
FT                   WPRARDLMPVIVAWLLSIGIVVLEKDLGTSLLFFGIVLVMLYIATERAVWVGLGLSLFG
FT                   IGCFIAFNLFDHVQGRVNTWLDPMATAGQDPDPGFQLRGGLYGMASGGIFGSGLGGGRP
FT                   DLTIWAASDFIIAAIGEELGLVGLMALLMVYLLLMMRGLRTALAVRDSFGKLFGGGLAF
FT                   TVCLQLFVVAGGVTGLIPMTGLTAPFLAYGGSSLLANYILVALLLRISDAARRPQAPSK
FT                   PKPKQAPIAEAHTELVERPR"
     atgtcacagc cggccgccgc agccggaacg cagaccccca gcggccacac cccggaaccc        60
     ggggttccca cccgtcgggg gaccgagctg ttcctgctca tctgctccgc ggtgatcatc       120
     accgtcgcga tcatgctggt gcagatcagc cgcgagcaga cgatcagccg cgagctgttc       180
     tactacggtg ccgcgttcct ggcgctgttc ggagcagcgc acttcgccgt gcgcaggtgg       240
     gcgccctacg cggacccgct gatcctgccg ctggtgtcgc tgatcaacgg cctgggactg       300
     gtggtgctgc accgcctcga cttcgaggag gtcaccggct cgccgttcac gggcaagcag       360
     atcatgttcg ccaccgtcgg cgtggtgctg ttcatcctgg tgctcgcgct ggtcaaggac       420
     caccggacgc tggcccgcta cagcttcacc tgcggattcg tcggcctggc gctgctggcc       480
     ctgccgggtc tgctgcctag cagcatctcg gaggtcaacg gtgcgaagct gtggatcaac       540
     atcggcgggc agtcgatcca gccgggcgag ttcgccaagc tgctgctgct gatcttcttc       600
     gcgtccttcc tggtgtccaa gcgcgagctg ttcaccacgg cgggccgccg cttcctgggc       660
     gtggactggc cgcgggccag ggacctgatg ccggtgatcg tggcgtggct gctgtccatc       720
     ggcatcgtcg tgctggagaa ggacctcggc acctcgctgc tgttcttcgg catcgtgctg       780
     gtgatgctct acatcgccac cgagcgcgcg gtttgggtcg gcctcggcct gtcgctgttc       840
     gggatcggct gcttcatcgc gttcaacctc ttcgaccacg tccagggccg ggtgaacacc       900
     tggctggacc cgatggccac cgcgggccag gacccggacc ccggcttcca gctgcggggc       960
     gggctctacg gcatggccag cggcggcatc ttcggctcgg gtctgggagg cggcaggccc      1020
     gacctgacga tctgggctgc cagcgacttc atcatcgccg ccatcggcga ggagctcggc      1080
     ctggtcgggc tgatggcgct gctgatggtc tacctgctgc tgatgatgcg cggcctgcgc      1140
     accgcgctgg cggtccgcga ctcgttcggc aagctcttcg gcggcggcct ggcgttcacc      1200
     gtctgcctgc agctgttcgt cgtcgcgggc ggcgtcaccg ggctgatccc gatgacgggt      1260
     ctcaccgctc ccttcctcgc atacggtggt tcgtcactgc tggcgaacta catcctggtc      1320
     gctctgctgt tgcggatctc cgacgccgcg cgccggccgc aggccccgtc gaagccgaag      1380
     cccaagcagg ctccgatcgc cgaagcacat accgaactgg tggagcgtcc ccgatga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page