(data stored in SCRATCH zone)

EMBL: AM420293.GCVH

AM420293.GCVH        Location/Qualifiers
FT   CDS_pept        547999..548394
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="SACE_0494"
FT                   /product="glycine cleavage system H protein"
FT                   /function="Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99842"
FT                   /db_xref="GOA:A4F718"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A4F718"
FT                   /protein_id="CAL99842.1"
FT                   /translation="MVNIPQGLKYTQDHEWVEARSGDTVRIGITDHAQRELGDIVFVEM
FT                   PEVGRRVSGAEALGSVESVKAVAEFFAPLGGEVVEVNSQVSDEPELVNTDPYGDGWIVA
FT                   IKVADRSELDSLMSAEQYGEFVAEANE"
     gtggtcaaca tcccgcaggg tctcaagtac acccaggacc acgagtgggt cgaggcgcgg        60
     tccggcgaca cagtcaggat cggcatcacc gatcacgcgc agcgggagct cggtgacatc       120
     gtcttcgtgg agatgccgga ggtgggccgc cgcgtcagcg gcgccgaggc gctcggcagc       180
     gtggagtcgg tcaaggcggt cgcggagttc ttcgcaccgc tgggcggcga ggtcgtggag       240
     gtcaacagcc aggtgagcga cgagccggag ctggtgaaca ccgatcccta cggtgacggc       300
     tggatcgtcg cgatcaaggt cgccgaccgg tccgagctgg actccctgat gtccgcggag       360
     cagtacgggg agttcgtcgc cgaagcgaac gagtag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page