(data stored in ACNUC1104 zone)

EMBL: AM420293.GLXK

AM420293.GLXK        Location/Qualifiers
FT   CDS_pept        complement(121204..122355)
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="SACE_0098"
FT                   /product="glycerate kinase"
FT                   /function="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99451"
FT                   /db_xref="GOA:A4F5X7"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X7"
FT                   /protein_id="CAL99451.1"
FT                   /translation="MRFLVAPTGFKECLDAREVADAIGAGIRRVVPRAVVDAMPLIDGG
FT                   EGSARQLAGTTGGELVPVVVTGPVGEPVRSHFALLGGDGPRTAFVEVAAAAGLSLVPPG
FT                   RRDPGLTTSRGVGELIAAALDAGTTRVVVGCGDSGICDGGAGALQALGAGVLDSTGRPV
FT                   GSGGYALARARRIDTSGLDPRLRGVKLVIAANPSNVLTGPHGVARVFGPQKGATPAQVE
FT                   EMAAAMSIWADLLRGHGGARIADLPGSGASGGLGAGLAAGLGGTLRSRFDVLFDQADLD
FT                   RRLAVADLVITGEGAIDASTARGKVPAEVARLAKRRGKPVLAITGTIGPGAESSYDIGI
FT                   DAIAGILTGPVDLADAISRAPELISDATARTLRMLLLGRSLAA"
     atgcgattcc tggtcgctcc caccgggttc aaggagtgcc tcgacgcgcg ggaggtcgcc        60
     gatgccatcg gcgcgggcat ccgccgcgtg gtgccgcggg ccgtcgtcga cgccatgccg       120
     ctgatcgacg gcggggaggg gtcggcccgg cagctcgcgg gcacgaccgg cggcgagctg       180
     gtgccggtcg tggtcaccgg accggtcggc gagccggtgc gctcgcactt cgcgctgctc       240
     ggcggcgacg ggccgcgcac cgcgttcgtc gaggtcgccg cggccgccgg tctctcgctg       300
     gtgccgcccg gccgccgcga cccggggctg accacgagcc ggggcgtcgg ggagctgatc       360
     gcggccgcgc tggacgcggg caccacccgc gtcgtcgtcg gctgcggcga ctccgggatc       420
     tgcgacggcg gtgccggggc gttgcaggcg ctgggggcgg gagtgctcga cagcaccggc       480
     aggcccgtcg gcagcggcgg ctacgcactc gcccgcgcac gccgcatcga caccagcggc       540
     ctggaccccc ggctgcgcgg cgtgaagctg gtgatcgccg cgaacccgag caacgtgctg       600
     accgggccgc acggcgtggc ccgcgtgttc ggaccgcaga agggcgcgac tccggcgcag       660
     gtcgaggaaa tggcggccgc catgagcatc tgggcggacc tgctgcgcgg gcacggcggc       720
     gcgcggatcg ccgacctgcc cggcagcggc gcctccggag gtctcggagc cgggctcgcg       780
     gccgggctcg gcggcaccct gcggtcccgg ttcgacgtgc tgttcgacca ggccgacctg       840
     gaccgccgcc tggccgtcgc cgacctggtg atcaccggtg agggcgccat cgacgcctcc       900
     accgcgcgcg ggaaggtccc cgccgaggtc gcccggctgg ccaagcgccg cgggaagccg       960
     gtgctggcca tcaccggcac catcggcccc ggggcggaga gcagctacga catcggcatc      1020
     gacgccatcg ccgggatact gaccggtccg gtggacctcg ccgacgccat cagccgcgca      1080
     cccgagctga tctccgacgc caccgcccgc accctgcgga tgctgctgct cgggcggtcg      1140
     ctcgcggcct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page