(data stored in ACNUC1104 zone)

EMBL: AM420293.HOLB

AM420293.HOLB        Location/Qualifiers
FT   CDS_pept        421727..422938
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="SACE_0379"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /function="ATPase involved in DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99727"
FT                   /db_xref="GOA:A4F6Q3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q3"
FT                   /protein_id="CAL99727.1"
FT                   /translation="MDVTPELTTGVWADVVGQPEAVRTLRAAVRAADLLARGEPAPAGA
FT                   MTHAWLFTGPPGSGRSVAARSFAAALQCTSGEGCGHCSACRTVQAGTHADVRVVVPEGL
FT                   SISVSEMRSLVQASARRPTTGQWRVVLIEDSDRLTEGASNALLKAVEEPPDRTVFLLCA
FT                   PSDHPEDVSVTIRSRCRVVQLKTPRPDAIAEVLAERDGIEPRMAQWAASVSGGHIGRAR
FT                   RLATDGEARERREAVLSVPLGLRRFSDVFTAAGGLVKASETDAVAANEDRNEAEKEELR
FT                   TAMGAGGTGKGTAAATRGANAAIRELEKRQKSRATRSQRDALDLALVDLAGFYRDVLVV
FT                   RSGSTAALNHPDFARSVSKAAAEWTSESTLRRLEAVLACRLALTQNVKPIIAVEAMAAA
FT                   LHRG"
     gtggacgtga ccccggagct gaccaccggc gtgtgggccg acgtcgtcgg ccagccggaa        60
     gcggtgcgaa cgctgcgcgc ggccgtgcgc gccgccgacc tgctggcccg cggcgagccc       120
     gcgccggcag gcgcgatgac ccacgcctgg ctgttcaccg gccctccggg ctccgggcgc       180
     tcggtcgccg cccggtcctt cgccgcggcg ctgcagtgca cctccggcga gggctgcggg       240
     cactgctcgg catgccggac ggtccaggcg ggcacgcacg ccgacgtgcg ggtcgtcgtg       300
     ccggaggggt tgtcgatctc ggtgtcggag atgcggtcgc tggtgcaggc gtcggcgcgc       360
     aggccgacga ccgggcagtg gcgggtcgtg ctgatcgagg actccgaccg gctcaccgag       420
     ggagcgtcga acgcgctgct caaggcggtc gaggagcccc cggaccggac ggtgttcctg       480
     ctctgcgcgc cttcggacca ccccgaggac gtgtcggtga cgatccgctc ccgctgccgg       540
     gtcgtgcagc tcaagacccc ccggccggat gcgatcgcgg aagtgctggc cgagcgagac       600
     ggcatcgagc cgcggatggc gcagtgggcc gcttcggtca gcggcgggca catcggccgc       660
     gcccggcggc tggccaccga cggcgaggcg cgcgagcggc gggaggcggt gctcagcgtc       720
     ccgctggggc tgcgccggtt ctccgacgtg ttcaccgccg ccggaggcct ggtcaaggcg       780
     tccgagacgg atgcggtcgc ggccaacgag gaccgcaacg aggccgagaa ggaggagctg       840
     cgcaccgcca tgggcgccgg cggcaccggc aagggcacgg ccgccgccac ccgaggcgcg       900
     aacgcggcga tccgggagct ggagaagcgg cagaagtccc gcgcgacccg gtcgcagcgc       960
     gacgcgctgg acctggcact ggtcgacctc gcgggcttct accgggacgt gctggtggtg      1020
     cgctcgggtt cgacggcggc gttgaaccac cccgacttcg cccgctcggt ttcgaaggcg      1080
     gccgcggagt ggacgtcgga gtcgacgctg cgccggctcg aagcggtgct cgcgtgccgg      1140
     ctcgcgctca cccagaacgt caagccgatc atcgcggtgg aggcgatggc cgccgccctg      1200
     cacagaggct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page