(data stored in ACNUC1104 zone)

EMBL: AM420293.ILVB

AM420293.ILVB        Location/Qualifiers
FT   CDS_pept        669203..670885
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SACE_0604"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99949"
FT                   /db_xref="GOA:A4F7C5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C5"
FT                   /protein_id="CAL99949.1"
FT                   /translation="MTVESFPNAWHAVVDHLREAGVSVLFGLPGDDLEALCALEKAGMR
FT                   MVLCRDQRNAVCMAAGYAIQSGRPGVCVVGKGPAVANAVGGLLEARSAGAPVVVLAGGT
FT                   GTDRRGSGAFQELDQVPLVTPVVKWAHRIDHPDRVVPAVEKAFLLAGAGAAGPVYLEIP
FT                   DHLAHVPVNRFREWTPPALVGATAVPGTGPAVAALEASRRPVLLVGGGMRHRNGDGAVE
FT                   SFADTAGAAVFSTASGRGTASEEHPLFCGLSGLYCPEAAAELWRTTDLVVAVGTALEET
FT                   ATYGWDGAIGAETPVVQVNCDAGGLSTEYGGLRVVGDGADVLGAWTRALASKPPDESWL
FT                   AAIARCRADVWAHTEDRLARMAADDGLHVAEVLAAIDAVAPPSRILVQENGLQDMWSYF
FT                   YPYHVCRTRGGSLVPSEQTTLGFGAAASAGARLAAPDRPVIAFVGDGAFATVRSELPAL
FT                   RREGVGVVYVVLRNGGYGWLHAQVTSRGLDHRLHPFAADEEEQPEGAVVRQKSQLEDAL
FT                   RDALATCEQGGGPAIVHIDVQLTDTPPGITGLDGDFPSHANEI"
     gtgaccgtgg aaagcttccc caacgcctgg cacgccgtcg tggaccacct gcgcgaagcc        60
     ggcgtctccg tcctgttcgg actgcccggc gacgacctcg aagcgctttg cgcgctggag       120
     aaggcaggca tgcggatggt gctgtgccgg gaccagcgca acgcggtgtg catggcagcc       180
     ggttacgcga tccagtccgg gcggcccgga gtgtgcgtgg tgggcaaggg cccggcggtg       240
     gcgaacgcgg tcggcgggct gctcgaggcg cgcagcgccg gcgcgccggt ggtggtgctg       300
     gccggaggca cgggcaccga ccgccggggc agcggcgcgt tccaggagct cgaccaggtc       360
     ccgctggtga cgccggtcgt gaagtgggcg caccggatcg accaccccga ccgggtcgtg       420
     cccgcggtgg agaaggcgtt cctgctcgcc ggggcgggtg ccgcgggccc ggtgtacctg       480
     gagatcccgg accacctggc gcacgtgccg gtcaaccggt tccgggagtg gacgccgcct       540
     gccctggtcg gcgcgaccgc ggtgcccggc accgggccgg ccgtcgccgc gctggaggcg       600
     agccggcgtc cggtcctgct ggtgggcggg ggaatgcggc accgcaacgg ggacggggcc       660
     gtggagtcct tcgccgacac cgccggtgcg gccgtgttca gcaccgcgtc gggccgcggc       720
     accgcgtcgg aggagcaccc gctgttctgc gggctgtccg ggctctactg cccggaggcc       780
     gccgccgagc tgtggcgcac cacggacctg gtggtcgcgg tgggcaccgc gctggaggag       840
     accgccacct acggctggga cggggccatc ggcgccgaaa cccctgtcgt gcaggtgaat       900
     tgcgacgcgg gcggtctgtc gaccgagtac ggcggcctcc gcgtggtggg cgacggtgcc       960
     gacgtgctgg gcgcgtggac ccgtgcgctg gcatcgaagc ccccggacga gtcgtggctg      1020
     gcggcgatcg cgcgctgccg cgccgacgtg tgggcgcaca ccgaggaccg gctggcgcgg      1080
     atggcggctg acgacggcct gcacgtggcc gaggtgctcg cggcgatcga cgcggtggcg      1140
     ccgccgtcgc ggatcctggt gcaggagaac ggactgcagg acatgtggtc gtacttctac      1200
     ccgtaccacg tgtgccgcac gcgcggcgga agcctggtcc cctcggagca gaccacgctc      1260
     ggcttcggcg ctgccgcctc cgcgggcgcc aggctcgccg cgccggaccg cccggtcatc      1320
     gccttcgtcg gcgacggcgc gttcgccacc gtccgctccg agctgcccgc cctgcgccgc      1380
     gagggcgtcg gcgtggtcta cgtcgtgctg cgcaacggcg gttacggctg gctccacgcg      1440
     caggtcacca gccggggcct ggaccaccgg ctgcacccgt tcgccgccga cgaggaggag      1500
     cagccggaag gcgcggtcgt caggcagaag tcccagctcg aagacgcgct gcgggacgcg      1560
     ctggccacct gcgagcaagg cggcgggccg gcgatcgtcc acatcgacgt ccagctcacc      1620
     gacaccccgc ccggcatcac cggactcgac ggagatttcc ccagccatgc caacgagatc      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page