(data stored in ACNUC1104 zone)

EMBL: AM420293.LYSC,-ASK

AM420293.LYSC,-ASK   Location/Qualifiers
FT   CDS_pept        315127..316392
FT                   /transl_table=11
FT                   /gene="lysC, ask"
FT                   /locus_tag="SACE_0282"
FT                   /product="aspartate kinase"
FT                   /function="Aspartokinases"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99631"
FT                   /db_xref="GOA:A4F6F7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F7"
FT                   /protein_id="CAL99631.1"
FT                   /translation="MALVVQKYGGSSLESADRIKRVAERIVETRKAGNDVVVVCSAMGD
FT                   TTDELLDLAQQVNPAPPERELDMLLTAGERISNALVAMAIEALGAEARSFSGSQAGVIT
FT                   TSAHQNARIIDVTPGRVQEALKQGQVVLVAGFQGVAQDTKDITTLGRGGSDTTAVAVAA
FT                   AMNADVCEIYTDVDGVYTADPRIVSDAKHLDRITYEEMLEMAATGAKVLHLRAVEYARR
FT                   YGVPLHVRSSYSPKSGTIVSGSVEDLSVEQAMITGVAHDRSEAKVTVRGVPDNPGIAGR
FT                   IFRVIADAEIDIDMVLQNVSGTASGRTDITFTVARSNGALAVTELEKIKDELGFDQVVY
FT                   DDHVGKVSLVGAGMRSHPGVTATFCEALSHAGVNIEIINTSEIRISVLIRDTQLEDAVA
FT                   ALHAAFELGGDEEAVVYAGSGR"
     gtggcgctcg tcgtccagaa gtacggcggt tcttcactcg agagtgccga tcgcatcaaa        60
     cgggtcgcag agcgcatcgt cgagacccgc aaggcgggca atgacgtggt cgtcgtgtgc       120
     tccgcgatgg gagataccac tgacgagctg ctcgacctcg cccagcaggt caacccggcc       180
     ccgccggagc gcgagctcga catgctgctc accgccggtg agcgcatctc caacgccctg       240
     gtcgcgatgg ccatcgaggc cctcggcgcc gaggcccgct cgttctcggg ctcccaggcc       300
     ggtgtgatca ccacttccgc ccaccagaac gcccgcatca tcgacgtcac gcccggccgg       360
     gtgcaggagg ccctgaagca gggccaggtc gtgctggtcg ccggtttcca gggcgtcgcc       420
     caggacacca aggacatcac gacgctcggc cgcggcggct cggacaccac ggcggtcgcg       480
     gtggccgccg cgatgaacgc cgacgtgtgc gagatctaca ccgacgtcga cggcgtctac       540
     accgcggacc cgcgcatcgt ctccgatgcc aagcacctgg accgcatcac ctacgaggag       600
     atgctcgaga tggcggcgac cggtgcgaag gtgctgcacc tgcgcgccgt cgaatacgcc       660
     cgccgctacg gcgtgcccct gcacgtccgc tcttcgtact cacccaagtc cggaacgatc       720
     gtttccggca gtgtggagga cctttccgtg gaacaggcga tgatcaccgg cgtcgcgcac       780
     gaccggtcgg aggccaaggt caccgtgcgc ggtgtgccgg acaacccggg tatcgcgggg       840
     cggatcttcc gcgtgatcgc cgatgccgag atcgacatcg acatggtgct gcagaacgtc       900
     tccggcaccg cgtcgggccg caccgacatc accttcaccg tggcgcgtag caacggcgcg       960
     ctggcggtga ccgagctgga gaagatcaag gacgagctcg gcttcgacca ggtggtctac      1020
     gacgaccacg tcggcaaggt ctcgctggtc ggcgcgggca tgcgctcgca ccccggcgtc      1080
     acggcgacct tctgcgaggc gctgtcgcac gccggcgtga acatcgagat catcaacacc      1140
     tcggagatcc ggatctcggt gctgatccgc gacacccagc tcgaggacgc cgtcgcggcg      1200
     ctgcacgcgg cgttcgagct cggtggcgac gaggaagccg tcgtctacgc ggggagtggt      1260
     cgctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page