(data stored in ACNUC1104 zone)

EMBL: AM420293.MIND2

AM420293.MIND2       Location/Qualifiers
FT   CDS_pept        403784..404944
FT                   /transl_table=11
FT                   /gene="minD2"
FT                   /locus_tag="SACE_0366"
FT                   /product="septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99714"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P0"
FT                   /protein_id="CAL99714.1"
FT                   /translation="MSAATSLPSSTPPTAPAGPRPLLITCDAELAEDVLRLAAAAGCDL
FT                   DRAPDPLSVGDRWRTAPLVLLDGPAAEAGVANGLPRRPRVLVLARAPGGDLYRAAFHIG
FT                   AEQEVILPAHEGHLIELLAEAVDRSAPRSGRVLAVIGGSGGAGASVLATGVAVTAARRG
FT                   QRSLLLDCDPLGGGLDLAVGAESTDGVRWSGLSVSGGRVAAGALHDALPQRRVGSGSLA
FT                   VLACDRDGPSSGLTPQAVGAVVDAGRRAGQTVVCDLPRHLSEAALAGLRKADLTLVVVA
FT                   AEVRACAAAARLVAEIRDRTAGRLRLVVRGPASSGLRVSDVGRAVGVEVLTAVRPQTGL
FT                   STALDRGGFCATRAGLRRTVERAASEVLRALGRTGTAPEHALVGAA"
     atgtccgccg ctaccagcct gccgtcttcc actccaccca ccgcccccgc aggcccacgt        60
     ccgctgctga tcacctgcga tgccgagctg gccgaggacg tcctgcgcct ggccgcggcg       120
     gcgggatgcg acctggaccg cgcgcccgac ccgctgtcgg tcggggaccg ctggcgaacg       180
     gcgccactgg tgctgctgga cggtcccgcg gccgaagcgg gcgtggcgaa cggcctgccg       240
     cgaagaccac gtgtgctcgt gctcgcccgc gccccgggag gtgatctgta ccgcgccgcc       300
     ttccacatag gcgcggagca ggaggtcatc ctgcccgcgc acgaggggca cctgatcgag       360
     ctgctcgcag aggcggtcga ccgttccgca ccgcgatcgg ggcgggtgct cgccgtcatc       420
     ggcggcagcg gaggcgcggg cgcgtcggtg ctggcgaccg gtgtggcggt gacggcggcg       480
     cggcgcggcc agcgctcgtt gctgctggac tgcgacccgc tgggcggagg cctggacctg       540
     gcggtcggcg cggagagcac cgacggcgtc cgctggtccg ggctcagcgt cagcggaggc       600
     cgggtggccg cgggcgcgtt gcacgacgcc ctgccgcagc gccgagtcgg ttccggctct       660
     ctcgccgtgc tggcctgcga ccgcgacggc ccgtcttccg ggctgacgcc gcaggcggtc       720
     ggagcggtgg tcgacgcagg gcggcgtgcc gggcagaccg tggtgtgcga cctgccgagg       780
     cacctctcgg aggccgcgct ggccggactg cggaaggccg atctcaccct cgtcgtcgtt       840
     gccgccgagg tccgcgcctg cgcggcggcg gctcggctgg tcgccgagat ccgcgaccgc       900
     acggccggac ggctgcgact cgtggtgcgc ggaccggctt cgagcggact gcgcgtgtcc       960
     gacgtcggcc gcgccgtcgg ggtcgaagtc ctcaccgccg tgcgcccgca gaccggcctg      1020
     tccacggcgc tggaccgcgg cggcttctgc gcgacacgtg ccggtctgcg ccggacggtg      1080
     gaacgagccg cttccgaggt gttgcgggcg ctcgggcgga ccggcaccgc cccggaacac      1140
     gccctggtcg gtgcggcatg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page