(data stored in SCRATCH zone)

EMBL: AM420293.MOAA

AM420293.MOAA        Location/Qualifiers
FT   CDS_pept        complement(628802..629851)
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="SACE_0569"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /function="Molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99914"
FT                   /db_xref="GOA:A4F790"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4F790"
FT                   /protein_id="CAL99914.1"
FT                   /translation="MDLGIPVVRPTTDMSTRPDTPHLVDRFGRIARDLRVSLIDKCNLR
FT                   CTYCMPAEGLPWLKRSELLDTGEMIRLIRIAVEELGVTNVRFTGGEPLLRQDLVDIISA
FT                   TSELPSKPKTSLTTNGINLGRYADALKRGGLNRVNVSLDTLDRDTFRELTRRDRFSDVL
FT                   EGLEAAKAAGLEPVKVNTVLMRGLNGHEACDLLRYCVEHDYQLRFIEQMPLDPQHGWDR
FT                   GQMITAEEILEMLGAEFDLTPHTAERGSAPAERWLVDGGPATVGVIGSVTRPFCATCDR
FT                   TRLTADGQLRSCLFSTTETDLRGPMRAGAGDEEIMRLWQETMWAKKAGHGMDTEGFAQP
FT                   SRPMSAIGG"
     gtggacctgg gaatcccggt cgtgcgtccc acgaccgaca tgtcgactcg ccccgacacc        60
     ccgcacctgg tggaccgctt cggccgcata gccagggacc tgcgggtgtc gctgatcgac       120
     aagtgcaacc ttcgctgcac ctactgcatg cccgccgagg ggctgccgtg gctcaagcgc       180
     tcggaactgc tcgacaccgg cgagatgatc cggctgatcc ggatcgcggt ggaggagctc       240
     ggcgtgacca acgtccgctt caccggcgga gaaccgctgc tgcgccagga cctcgtcgac       300
     atcatcagcg ccacctccga gctgccctcg aagccgaaga cgtcgctgac caccaacggc       360
     atcaacctcg gccgctacgc cgacgcgctc aagcgcggcg gcctgaaccg ggtcaacgtc       420
     tcgctcgaca cgctcgaccg cgacacgttc cgcgagctga cccgccggga ccggttctcc       480
     gacgtcctcg aaggactgga ggcggccaag gccgccgggc tggaaccggt gaaggtcaac       540
     acggtgctga tgcgcggact caacggccac gaggcgtgcg acctgctgcg ctactgcgtc       600
     gagcacgact accagctgcg gttcatcgag cagatgccgc tggacccgca gcacggctgg       660
     gaccgcggac agatgatcac cgccgaagag atcctggaga tgctcggcgc ggagttcgac       720
     ctgaccccgc acaccgccga acgcggctcg gcacccgccg agcgctggct cgtcgacggc       780
     gggcccgcga cggtgggcgt catcggctcg gtgacccggc cgttctgcgc gacctgcgac       840
     cgcacccggc tgaccgccga cgggcagctg cggtcgtgcc tgttctcgac caccgagacc       900
     gacctgcgcg ggccgatgcg ggcgggagcg ggcgacgagg agatcatgag gctgtggcag       960
     gagacgatgt gggcgaagaa ggccgggcac ggcatggaca ccgagggctt cgcccagccg      1020
     tcgcgaccga tgagcgcgat cgggggctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page