(data stored in SCRATCH zone)

EMBL: AM420293.MOAA3

AM420293.MOAA3       Location/Qualifiers
FT   CDS_pept        complement(578372..579562)
FT                   /transl_table=11
FT                   /gene="moaA3"
FT                   /locus_tag="SACE_0523"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /function="Molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99869"
FT                   /db_xref="GOA:A4F745"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4F745"
FT                   /protein_id="CAL99869.1"
FT                   /translation="MPEYQQRIAELLAPTPVEPRALEDCLGLALATDLTASIPLPPFDN
FT                   SAMDGYAVRSVDLAGADEQNPVVLPVPEDVPAGRVQNPPLQPGTAHRIMTGAQVPPGAD
FT                   AVIPVERTDGGVTEVRAYAQVQPGAHIRRAGEDVASGATVLSAGTSLTPPQLGVAAAVG
FT                   AERLPVHRPVRVLILSTGSELVAPGTPLEPGQIYESNGLMLASAVRAADADARLLRFVP
FT                   DDVHAFHAVLSPHLDSTDLIITSGGVSAGAYEVVKDALSGNGVEFTKVAMQPGMPQGCG
FT                   RYRGGPAVVALPGNPVSAMVSFEVFVRPVLRAAAGHSRTRREVRQATLTEELVAPAGKR
FT                   QYRRAVFDPATGEVRTQGGTGSHLLTAMAAANCLLEIPEETTTLPEGSTVDVLLVD"
     gtgcccgagt accagcagcg catcgcggag ctgctcgcac cgaccccggt cgagccgcgt        60
     gcgctggagg actgcctcgg gctggccctg gccaccgacc tcaccgcgtc catcccgctg       120
     ccgcccttcg acaactccgc gatggacggc tacgcggtcc gttcggtcga cctggcgggc       180
     gccgacgagc agaacccggt cgtgctgccg gttccggagg acgttcccgc gggccgggtg       240
     cagaacccgc cgctgcagcc cggcaccgcg caccggatca tgaccggcgc ccaggtgccg       300
     cccggagccg acgccgtcat cccggtcgag cgcaccgacg gcggtgtcac cgaggtccgc       360
     gcgtacgcgc aggtgcagcc cggtgcgcac atccgccgcg cgggcgagga cgtcgcgtcc       420
     ggcgcgacag tgctcagcgc gggtacctcg ctcacgcccc cgcagctcgg ggtggccgcg       480
     gccgtcgggg ccgagcggct gccggtgcac cggccggtgc gggtgctgat cctgtcgacc       540
     ggctcggagc tggtggcgcc cggcacgccg ctggagccgg ggcagatcta cgagtccaac       600
     ggcctcatgc tcgcctcggc ggtgcgcgcc gcggatgcgg acgcgcggct gctgcgcttc       660
     gtcccggacg acgtgcacgc cttccacgcc gtgctgtcgc cgcacctgga ctccaccgac       720
     ctgatcatca cctccggcgg cgtcagcgcg ggtgcgtacg aggtggtcaa ggacgccctc       780
     agcggcaacg gcgtggagtt caccaaggtc gcgatgcagc cgggcatgcc gcagggctgc       840
     ggccgctacc gcggcggccc ggcggtggtg gcgctgccgg gcaacccggt cagcgcgatg       900
     gtgtccttcg aggtgttcgt gcgtccggtg ctgcgcgccg ccgccgggca ctcccgcacc       960
     cggcgcgagg tccgccaggc gacgctgacc gaggagctgg tcgcgccggc gggcaagcgc      1020
     cagtaccgga gggcggtgtt cgacccggcg accggtgagg tccggacgca gggcggcacg      1080
     ggttcgcacc tgctgacggc gatggcggcg gccaactgcc tgctggagat cccggaggag      1140
     acgaccacgc tacccgaggg ctccacagtg gacgtgctgc tggtggattg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page