(data stored in SCRATCH zone)

EMBL: AM420293.MOAC

AM420293.MOAC        Location/Qualifiers
FT   CDS_pept        623958..624437
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="SACE_0564"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /function="Molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99910"
FT                   /db_xref="GOA:A4F786"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A4F786"
FT                   /protein_id="CAL99910.1"
FT                   /translation="MAQSDLTHVDEAGAARMVDVSGKQVTARTAVASGVLRTTAEVIGL
FT                   LRRDGLPKGDALATGRLAGIMAAKRTPDLIPLCHPIALSGVKVDLEVGDAEVRITATVR
FT                   TTDRTGVEMEALTAVTGAGLALHDMIKAVDPAAVLDAVRVERKEGGKTGTWVREE"
     atggcgcaga gcgatctcac gcacgtcgac gaggcgggcg cggcccgcat ggtcgacgtg        60
     tccggcaagc aggtgaccgc ccggacggcg gtggcgagcg gagtgcttcg caccaccgcc       120
     gaggtcatcg gcctgctgcg gcgcgacggg ctgcccaagg gcgacgcgct ggcgaccggc       180
     aggctcgccg gcatcatggc cgccaagcgc acgcccgacc tgatcccgct gtgccatccc       240
     atcgcgctgt cgggcgtcaa ggtcgacctg gaggtcggtg acgcggaggt gcggatcacc       300
     gcgaccgtgc gcaccaccga ccgcaccggc gtcgagatgg aggcgctcac cgccgtcacc       360
     ggcgccgggc tcgcgctgca cgacatgatc aaggccgtcg accccgccgc cgtgctcgac       420
     gccgtgcgcg tcgagcgcaa ggagggcggc aagaccggca cctgggtacg cgaagagtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page