(data stored in ACNUC1104 zone)

EMBL: AM420293.MRCB

AM420293.MRCB        Location/Qualifiers
FT   CDS_pept        complement(427778..429781)
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SACE_0385"
FT                   /product="membrane carboxypeptidase, penicillin-binding
FT                   protein"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99733"
FT                   /db_xref="GOA:A4F6Q9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q9"
FT                   /protein_id="CAL99733.1"
FT                   /translation="MSDDATTVLVPAARRRRRLRRALRASVFTATALLLGAVGAFAVGY
FT                   AVWEVPDPRAVATGTQQSIVLQYADGTEMTRIVPGTGNRTMIGSLHEVSPAMRQATLAA
FT                   EDASFYSNGGFDVLGIVRAAYAQLTDSPGGGSTLTQQYIKLATGEDEHTYTRKFKEIVL
FT                   SAKMTNEQPKDEIFKAYLNTAYYGRGAWGVHAASNAYFGKLPRDLDASEAAVLAGAVQK
FT                   PTENDPRVNAAQAAKRWEYVADQMLANHMITGEQRRRMAVPPTRERFAWRGEEMSGPLF
FT                   HIRERVLEELERDGLTARDMHRDGNTVVTNIDRDAQRAAEEAVAAMTEGRSQNLRSALV
FT                   SIEPGTGAIRAYHSGDREIGGFDWARAAQPPGAAMQPFVVAAGLMRGHGLAETYDGTSP
FT                   HEIMGATYRNSGVDCSRTCTARMAMAEASETAFVNMAAKFGPAAVLDAAQRAGMRVDTG
FT                   DDGRRVGLGIATGDYPVSTVDVARGYATLAAGGADHEPRFVRRVLDRTGNEVRSFEPEP
FT                   RTAFGDDPEMSRDVSGNVTESLSWSAWGTNWALDGKRPVAVKSGIAQFGGSPDEAVTAW
FT                   TAGYTPQIATAVSLSASDERGRPQPVVDATSSQAGDVLTGPTWQRFMNAYLADEPVEPF
FT                   PDFGPVGRYAEPSGVPFPPVTTSVPLPPLADR"
     gtgagcgatg acgcgacgac cgtgctcgta ccggcggcac gccggcgcag acgcctgcgc        60
     cgggcgctgc gcgcctccgt gttcaccgcc accgcgctgc tgctcggcgc ggtcggcgcg       120
     ttcgccgtcg gctacgcggt gtgggaggtg ccggacccga gggccgtcgc cacgggcacc       180
     cagcagtcga tcgtgctcca gtacgccgac ggcaccgaga tgacccggat agtgcccggc       240
     accggcaacc gcaccatgat cggctccctc cacgaggtct cgcccgcgat gcggcaggcg       300
     acgctcgccg ccgaggacgc ctccttctac agcaacggcg gcttcgacgt gctcggcatc       360
     gtgcgcgccg cctacgccca gctcaccgac agccccggcg gcggatcgac gctcacccag       420
     cagtacatca agctcgcgac cggcgaggac gagcacacct acaccaggaa gttcaaggag       480
     atcgtgctct ccgccaagat gaccaacgag cagccgaagg acgagatctt caaggcatac       540
     ctcaacaccg cctactacgg tcgcggtgcg tggggcgtgc acgccgcctc caacgcctac       600
     ttcgggaagc tgccgcgcga cctcgacgcc tcggaggccg ccgtgctcgc gggcgcggtg       660
     cagaagccga ccgagaacga cccgcgggtc aacgccgcgc aggccgcgaa gcgctgggag       720
     tacgtcgccg accagatgct ggccaaccac atgatcaccg gcgagcagcg gcggcggatg       780
     gccgtgccgc cgacgcggga gcggttcgcc tggcgcggtg aggagatgtc cgggccgctg       840
     ttccacatcc gggagcgggt gctggaggag ctggaacgcg acgggctcac ggcccgggac       900
     atgcaccgcg acggcaacac cgtcgtcacc aacatcgacc gcgacgccca gcgcgcggcg       960
     gaggaggccg tcgccgcgat gaccgagggc aggagccaga acctgcgctc ggcgctggtg      1020
     tcgatcgagc cgggaaccgg cgcgatccgc gcttaccaca gcggcgaccg ggagatcggc      1080
     ggcttcgact gggccagggc cgcgcagccg ccgggggcgg cgatgcagcc gttcgtggtc      1140
     gcggccgggc tgatgcgggg gcacgggctc gccgaaacct acgacggcac gtcaccgcac      1200
     gagatcatgg gcgccaccta ccgcaactcc ggcgtcgact gctcgcgcac gtgcaccgcg      1260
     cggatggcga tggccgaggc gtcggagacg gccttcgtca acatggcggc gaagttcggc      1320
     ccggcggccg tgctggacgc ggcgcagcgc gcggggatgc gggtggacac cggggacgac      1380
     gggcggcggg tcggcctcgg catcgcgacc ggcgactacc cggtgagcac agtggacgtg      1440
     gcgcgcggtt acgcgacgct ggccgccggc ggtgccgacc acgagccccg cttcgtgcgg      1500
     cgggtgctgg accgcaccgg caacgaggtc aggtccttcg agccggagcc gcggaccgcc      1560
     ttcggcgacg acccggagat gagccgggat gtctcgggca acgtcaccga gtcgctgagt      1620
     tggagcgcgt gggggacgaa ctgggcgctg gacggcaaac gcccggtggc ggtcaagagc      1680
     gggatcgccc agttcggtgg ctccccggac gaggccgtga cggcgtggac ggccggctac      1740
     acgccgcaga tcgccaccgc ggtgtcgctg agcgccagcg acgagcgcgg acgcccgcag      1800
     ccggtcgtcg acgcgacctc gtcccaggcg ggggacgtgc tgaccggccc gacctggcag      1860
     cggttcatga acgcctacct cgcggacgaa ccggtcgagc cgttcccgga cttcgggccc      1920
     gtcggccgct acgcggagcc cagcggtgtc ccgttcccgc cggtcacgac gtcggttccg      1980
     ctgccgcccc tggcggaccg ataa                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page