(data stored in ACNUC1104 zone)

EMBL: AM420293.NAGA

AM420293.NAGA        Location/Qualifiers
FT   CDS_pept        complement(399346..401079)
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SACE_0363"
FT                   /product="beta-N-acetylglucosaminidase (putative secreted
FT                   protein)"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99712"
FT                   /db_xref="GOA:A4F6N8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N8"
FT                   /protein_id="CAL99712.1"
FT                   /translation="MAVVSASLTAIGNAAPAGDAHSWATRTMRGMTLEEKVGQLFVTYA
FT                   YGRTADTPHQANRDEFGVATPAEVVQKYHLGGIIHFNWTDSIYEPKQIAELSNGLQRAA
FT                   VTSGAKIPLLISTDQEQGQITRIKEPATQLPGNMALGAGRSPADAERAAVITGQELRAM
FT                   GLAQNFAPSGDVNVNPANPVIGVRSFSSDPALAAELTAAQVRGYQGYGAVTASVKHFPG
FT                   HGDTNQDSHEELPVIEHDRQQWEALDAPPFRAAIDAGTDTVMSAHIVVPKLDDSGEPST
FT                   LSRNVLTGMLREELGFRGVVVTDSLQMEGVRHKHPDAEIPVLALEAGADQLLMPQHLQV
FT                   AIDGVIGAVRSGRLTEKRIDQSVERILRMKAGRGVIDRPFVDVSKVDRIVGSPRNLEAA
FT                   QKITDRTTTLLRNDAAVLPLRQPPGRVLVTGAGASPTKALAGSITARGSQATALETGMK
FT                   PTPQQIDQAVQAAGQNDLTVVLTNAAWNEANASQRDLVRALQRSGKPVVAVAVRDPYDA
FT                   AHVDEVPTWLTTYSDKAVAMESLARTLFGEIAPVGKLPVPVPDPTRPGTDRYPFGHGLS
FT                   W"
     gtggccgtcg tatccgccag cctgaccgcc atcggcaacg ccgccccggc cggtgacgcc        60
     cactcgtggg ccactcgcac catgcgcggc atgacgctgg aggagaaggt cggccagctc       120
     ttcgtcacct acgcctacgg ccgcaccgcc gacaccccgc accaggccaa ccgggacgag       180
     ttcggcgtcg ccacccccgc cgaggtggtg cagaagtacc acctgggcgg catcatccac       240
     ttcaactgga cagacagcat ctacgagccg aagcagatcg ccgagctgtc caacggcctg       300
     cagcgggccg cggtgacctc gggcgcgaag atcccgctgc tgatctccac cgaccaggag       360
     cagggccaga tcacccggat caaggagccc gccacgcagc tgcccggcaa catggcgctg       420
     ggcgccgggc gctcgcccgc cgacgccgag cgcgcggcgg tgatcacggg tcaggagctg       480
     cgggcgatgg gcctggcgca gaacttcgcg ccgagcggcg acgtcaacgt caaccccgcg       540
     aacccggtca tcggtgtccg ctcgttctcc tccgaccccg cgctggccgc cgagctgacc       600
     gcggcgcagg tccgcggcta ccagggctac ggcgccgtca ccgcctcggt caagcacttc       660
     cccggtcacg gcgacaccaa ccaggacagc cacgaggagc tgccggtcat cgagcacgac       720
     cgccagcagt gggaggccct cgacgcgccg ccgttccgcg ccgcgatcga cgcgggcacc       780
     gacaccgtga tgagcgcgca catcgtcgtg ccgaagctcg acgactccgg tgagccgtcg       840
     acgctctcgc gcaacgtgct caccgggatg cttcgcgagg agctgggctt ccggggcgtg       900
     gtcgtcaccg actcgctgca gatggagggc gtgcggcaca agcaccccga cgccgagatc       960
     ccggtgctgg cgctggaggc cggtgccgac cagctgctga tgccgcagca cctgcaggtc      1020
     gccatcgacg gcgtgatcgg cgcggtgcgc tccggcaggc tcaccgagaa gcggatcgac      1080
     cagagcgtgg agcgcatcct gcggatgaag gcggggcgcg gcgtgatcga ccggcccttc      1140
     gtcgacgtgt ccaaggtgga ccggatcgtc gggtcgccgc gcaacctcga agccgcgcag      1200
     aagatcaccg accgcaccac gacgctgctg cgcaacgacg cggctgtgct gccgttgcgg      1260
     cagccaccgg gccgggtgct ggtgaccggt gcgggcgcga gcccgaccaa ggcgctggcg      1320
     ggcagcatca ccgcgcgcgg ttcgcaggcg accgcgctgg agaccggtat gaagccgaca      1380
     ccgcagcaga tcgaccaggc tgtccaggcg gccgggcaga acgacctgac cgtggtgctg      1440
     accaacgccg cgtggaacga ggccaacgcg tcgcagcgcg acctggtgcg cgcattgcag      1500
     cgaagcggta aaccggtggt ggcggtcgcg gtccgcgacc cctacgacgc cgcccacgtg      1560
     gacgaggtcc cgacctggct gacgacctac tcggacaagg cggtggcgat ggagtcgctg      1620
     gccaggacgc tgttcgggga gatcgcgccg gtcggcaagc tgccggtccc ggtgcccgac      1680
     ccgaccaggc cgggaaccga ccgctacccg ttcgggcacg gtctgagctg gtaa            1734
//

If you have problems or comments...

PBIL Back to PBIL home page