(data stored in ACNUC1104 zone)

EMBL: AM420293.OHRA

AM420293.OHRA        Location/Qualifiers
FT   CDS_pept        complement(221317..221733)
FT                   /transl_table=11
FT                   /gene="ohrA"
FT                   /locus_tag="SACE_0187"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /function="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99539"
FT                   /db_xref="GOA:A4F665"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4F665"
FT                   /protein_id="CAL99539.1"
FT                   /translation="MNVLYTAEATVTGQGRSGHIRSSDGTLDTGLSMPRELGGAGGAGT
FT                   NPEQLFAAGYASCFHSALHLVAGRAKVSSEGSSVTAHVSIGKDREGFGLAAELVVDLPG
FT                   VERERAEELVAQAHEVCPYSRATRDNIEVRVKVA"
     gtgaacgtcc tctacaccgc cgaggcgacc gtgaccggcc agggacgcag cggacacatc        60
     cgctcctccg acggcacgct ggacaccggc ctgagcatgc ccagggagct gggcggcgca       120
     ggcggtgccg gcaccaaccc cgagcagctc ttcgccgccg gctacgcgtc ctgcttccac       180
     agcgcgctgc acctggtcgc cgggcgcgcg aaggtctcgt cggagggatc gtcggtcacc       240
     gcgcacgtga gcatcggcaa ggaccgcgag ggcttcggcc tggccgccga gctggtggtc       300
     gacctgccgg gcgtggagcg cgagcgcgcc gaagaactgg tcgcgcaggc gcacgaggtg       360
     tgcccctact cccgcgccac cagggacaac atcgaggtgc gcgtcaaggt cgcgtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page