(data stored in SCRATCH zone)

EMBL: AM420293.PE101

AM420293.PE101       Location/Qualifiers
FT   CDS_pept        complement(127304..127558)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99456"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y2"
FT                   /protein_id="CAL99456.1"
FT                   /translation="MRSVPRALLLVLALALPIAAVVVSFAITDGPRVPDVPAQVRIGSS
FT                   PGPDQPVPSVAPPPGTPPAQLPPPPPDDDDDDHDADHDD"
     atgaggtcgg ttccccgcgc gctcctgctc gtcctggcgc tggcgctgcc gatcgcggcc        60
     gtcgtggtca gcttcgccat caccgacggg ccacgcgtcc cggacgtgcc cgcgcaggtg       120
     cggatcggca gctcgccggg cccggaccaa ccggtgccct cggtcgcgcc gcccccgggg       180
     acaccgcccg cccagctgcc gccgccaccg ccagacgacg atgacgacga ccacgacgcc       240
     gaccatgacg actga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page