(data stored in ACNUC1104 zone)

EMBL: AM420293.PE104

AM420293.PE104       Location/Qualifiers
FT   CDS_pept        132651..134600
FT                   /transl_table=11
FT                   /locus_tag="SACE_0106"
FT                   /product="hypothetical protein"
FT                   /function="predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99459"
FT                   /db_xref="GOA:A4F5Y5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y5"
FT                   /protein_id="CAL99459.1"
FT                   /translation="MIGALVVIYGHSSPLVGTGELFPPEWPVQPDEGVLMGFFAMSGFQ
FT                   ITESWIRDPHPARFAAKRVLRLWPPMLTVTLGMALVVGPMVTTLPVGEYFSAHGTWGYI
FT                   VNNAGMLTLKHELPGVFTGNPWPDAVNGSLWTLPMELLAYGGLYTLLLLGAGKQRYRWL
FT                   SVVALVGLVAWDRHLEDTPGAESAGSLLSVPIESLVAFLVAFALGVVLNLYRVPLSPVA
FT                   AAAGLGVLVLMPNNQVGSFLMTFAVSYAVIVTGHFWPSRLEVPGVWVNGSYGVYVWGFP
FT                   IQQLLAMAGIANQYLMLVCAAPLAYVMGTLSWKYVEDPTMRLRHYITPAQPEPSRKPSP
FT                   SLEDEEHGEADDEPDDDAFDDLADDLDGAEERNGADRRDRPAPPDRLDDREPRRAAFPE
FT                   SGRAAFPETEVTSLPAAEDATRRRMPPRDPSAPAHRRAADPGEPSHGSPSPWTPPTRRA
FT                   PDPAAAPSRPHQRPRPPASPGFPEASPSSPNGRSSRHATPPAAAQSGQPAPSAPYGPSG
FT                   PDSPASPRSAPPRPAGPAPRPGAVPGTWPVRPDAPRPDAPPSGGAAPPVPPRRPRPPRA
FT                   VAPPSSNGHRPPAPDEDSVLARRLSGAVEPPSGPRPAPPARGQGGRHARPDQRQSEEET
FT                   RPAMRSFPGEVDGT"
     atgatcggcg cgctcgtggt catctacggg cacagctctc cgctggtcgg cacgggtgag        60
     ctgttcccgc cggaatggcc ggtgcagccc gacgagggcg tgctcatggg gttcttcgcc       120
     atgagcggtt tccagatcac cgagagctgg atccgcgacc cgcatccggc gcgcttcgcc       180
     gccaagcgcg tcctgcggct gtggccgccg atgctcaccg tgacgctcgg catggcgctg       240
     gtcgtcggcc cgatggtcac aacgctgccc gtcggcgagt acttcagcgc gcacggcacg       300
     tggggctaca tcgtcaacaa cgcgggcatg ctcacgctca agcacgagct gccgggggtc       360
     ttcaccggca acccgtggcc ggacgcggtc aacggttcgc tgtggacgct gccgatggag       420
     ctgctcgcct acggcggcct ctacaccctg ctgctgctcg gcgcgggcaa gcagcgctac       480
     cgctggctct cggtggtcgc gctggtcggt ctggtggcct gggacaggca cttggaggac       540
     accccgggcg cggagtcggc gggctcgctg ctgagcgtgc cgatcgagtc gctggtggcg       600
     ttcctggtgg cgttcgcgct gggagtcgtg ctcaacctct accgcgtccc gctctcgccc       660
     gtcgcggctg ccgcgggact cggcgtgctg gtgctgatgc cgaacaacca ggtcggctcg       720
     ttcctgatga ccttcgccgt cagctacgcg gtcatcgtga ccggccactt ctggccttcg       780
     cggctggagg tgccgggggt gtgggtcaac ggcagctacg gcgtctacgt ctggggcttc       840
     ccgatccagc agctgctggc gatggcgggc atcgccaacc agtacctgat gctggtctgc       900
     gccgcgccgc tggcgtacgt gatgggcacg ctgtcgtgga agtacgtcga ggaccccacg       960
     atgcggctgc ggcactacat caccccggcg cagccggagc cgtcgcgcaa gccgtcgccg      1020
     tcgctggagg acgaggagca cggcgaggcc gacgacgaac cggacgacga cgccttcgac      1080
     gatcttgccg acgacctcga tggtgctgag gagcggaacg gcgccgaccg ccgtgatcgc      1140
     ccagcgccgc ccgaccgcct cgacgaccgg gaaccccggc gcgcagcttt ccccgaatcc      1200
     gggcgcgcag ctttccccga gacggaggtg acatcccttc ccgccgccga ggacgccact      1260
     cgacgccgaa tgccgccccg cgacccgtcg gcgccggcgc accgacgcgc cgccgatccc      1320
     ggggagcctt cccacggctc tccgtcaccg tggacaccgc cgacccggcg ggccccggac      1380
     ccggccgcag ccccgtctcg cccgcaccag cggccccggc cgcccgcgtc ccccggcttc      1440
     cccgaggctt cgccgtcatc ccccaacggc cgctcatccc gccacgccac accccccgcg      1500
     gccgcacagt ccggacagcc ggctccctcc gctccctacg gcccgtccgg gccggactcg      1560
     ccggcttcgc cgcgctccgc cccgccccgg cccgccgggc ccgctccgcg gcccggcgcg      1620
     gtgccgggca cgtggcccgt gcgcccggac gctccgcgcc cggacgctcc gccgtcgggc      1680
     ggcgcggcac ctccggtgcc accgcgccgc ccgcgcccgc cgcgcgccgt tgcgccgccg      1740
     agctccaacg gccaccgtcc gccggctccg gacgaggact ccgtcctcgc ccgccggctc      1800
     tccggcgcgg tcgagccgcc gtcggggccg cgccccgcgc ctccggcgcg cgggcagggc      1860
     ggtcggcacg cccgaccgga ccagcggcag tccgaggagg agacccgtcc cgcgatgcgg      1920
     tcgtttcccg gagaggtgga cggcacgtga                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page