(data stored in ACNUC1104 zone)

EMBL: AM420293.PE107

AM420293.PE107       Location/Qualifiers
FT   CDS_pept        complement(136840..137538)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0109"
FT                   /product="protein of unknown function DUF867"
FT                   /function="Phage-related replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99462"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y8"
FT                   /protein_id="CAL99462.1"
FT                   /translation="MGVDTGRTPLPAGLPARAADTYPSNTALYADPALVHGTDYRIRHR
FT                   RHRTPSPPAVIAPHGGEIEAGTSELCLAIATWPDGAAFDYWAFEGLRSPSALHVTSTRC
FT                   DDPLALSLCARSPCALSLHGCRAEQTGTDRDAQSVLVGGRDGTTRHHLIRELRRAGFDA
FT                   TDASSHGVLSGMSPANICNRTRRGRGSQLEITTPLLDAMFTSNTIEGRKHTRTPVFWAF
FT                   VAAVRAAFLQ"
     atgggagtcg acaccggacg gacacctctt ccggccggtc ttccggccag ggccgcggac        60
     acctacccgt cgaacaccgc gctttacgcg gacccggcgc tggttcacgg caccgactac       120
     cgcatccggc accggcggca ccgcacgcct tcccctccgg ccgtcatcgc cccgcacgga       180
     ggggagatcg aagccgggac ctcggagctg tgcctggcga tcgccacctg gccggacggc       240
     gccgccttcg actactgggc cttcgagggg ctgcgctcgc cgagcgccct gcacgtcacc       300
     tcgacccgtt gcgacgatcc gctcgcactg tcgctctgcg cgcgcagccc ttgcgcgctg       360
     agcctgcacg gctgccgcgc ggagcagacc ggcaccgacc gcgacgcgca gtccgtcctg       420
     gtcggcggcc gcgacgggac cacccggcac cacctcatcc gcgagctgcg ccgcgccggc       480
     ttcgacgcca ccgacgcctc ctcccacggc gtcctcagcg gcatgtcccc ggccaacatc       540
     tgcaaccgga cgcgcagggg ccgcggcagc cagctggaga tcaccacgcc cctgctcgac       600
     gccatgttca ccagcaacac catcgaaggc cgcaaacaca ccaggacacc cgtcttctgg       660
     gccttcgtgg cagcggtccg cgcggcgttc ctccagtga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page