(data stored in ACNUC1104 zone)

EMBL: AM420293.PE113

AM420293.PE113       Location/Qualifiers
FT   CDS_pept        142234..143502
FT                   /transl_table=11
FT                   /locus_tag="SACE_0115"
FT                   /product="sensor kinase, two-component system"
FT                   /function="putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99468"
FT                   /db_xref="GOA:A4F5Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z4"
FT                   /protein_id="CAL99468.1"
FT                   /translation="MSNPNIDVVPELLTERTVLTTLAALAVLAMFVMLCRSRRVSTSVE
FT                   DATLAALHQVTSAAPHLRAGLTQESADQTAPHLRALLGCIAVGVVDAEGTLLSWDGEAN
FT                   HHYGGLRTRIEQVLRTGKREYVDHGEVACEQRPCVMRHAVVVPLEVEGENRGALVIISA
FT                   GDRRRLLRAAGEVANHVSTQLELAELQESKERLARAEVRALRAQISPHFIYNALNTISS
FT                   QIRNDPEQARDLLQEFADFTRYSFRTSGLYTTLADEIRNIDRYLTLERARFGPDRLKVQ
FT                   LKIAPEVLPVVVPFLALQPLVENAVRHGLANKPGGGTVSVIAEDNGVEALISVDDDGIG
FT                   MNPERLDAELADAHLTGAHVGLGNINNRMRATFGNDYGLVVETEEGAGMKVIMRVPKFA
FT                   PGVRPVPAQAIEEPSVGLAAGPQ"
     gtgtcgaacc ccaacattga tgttgtgccg gagcttctga ctgagcggac ggtgctgacc        60
     acgctcgccg cgctagccgt gctcgcgatg ttcgtgatgc tgtgccggtc gcgacgggtg       120
     agcacctcgg tcgaggacgc cacgctcgcg gccctgcacc aggtgaccag cgccgcgccg       180
     cacttgcggg cggggctgac gcaggaatcc gcggaccaga ccgcgccgca cctgcgcgcc       240
     ctgctggggt gcatcgcggt cggcgtggtc gacgccgagg gcacgctgct cagctgggac       300
     ggcgaggcca accaccacta cgggggactg cgcacccgga tcgagcaggt gctgcgcacc       360
     ggcaagcgcg agtacgtcga ccacggcgag gtggcgtgcg agcagcggcc gtgcgtgatg       420
     cggcacgccg tggtggtgcc gctggaggtg gagggggaga accggggcgc gctggtgatc       480
     atctccgccg gagaccgcag gcgcctgctg cgcgccgcgg gcgaggtggc caaccacgtg       540
     tccacgcagc tcgaactggc cgagctccag gagtccaagg agcggctggc gcgggccgag       600
     gtccgggcgc tgcgggcgca gatctcgccg cacttcatct acaacgcgct caacaccatc       660
     tcctcgcaga tccgcaacga ccccgagcag gcgcgggacc tgctccagga gttcgccgac       720
     ttcacccgct actcgttccg gaccagcggc ctctacacca cgctggccga cgagatccgc       780
     aacatcgacc ggtacctgac gctggagcgc gcccgcttcg gccccgaccg gctcaaggtg       840
     cagctcaaga tcgccccgga ggtccttccg gtggtggtgc cgttcctggc gttgcagccg       900
     ctggtcgaga acgcggtgcg gcacggcctg gccaacaagc ccggtggcgg cacggtctcg       960
     gtgatcgccg aggacaacgg ggtggaggcg ctgatcagcg tcgacgacga cggcatcggc      1020
     atgaacccgg aacggctgga cgccgagctc gccgacgcgc acctgaccgg cgcgcacgtc      1080
     ggcctgggca acatcaacaa ccggatgcgc gcaaccttcg gcaacgacta cggcctggtc      1140
     gtggagaccg aggagggcgc gggcatgaag gtgatcatgc gcgtgccgaa gttcgcgccc      1200
     ggggtgcgcc cggtacccgc gcaggcgatc gaagagccct cggtcgggct ggcggccgga      1260
     ccgcagtag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page