(data stored in ACNUC1104 zone)

EMBL: AM420293.PE114

AM420293.PE114       Location/Qualifiers
FT   CDS_pept        143710..144606
FT                   /transl_table=11
FT                   /locus_tag="SACE_0116"
FT                   /product="possible signal peptide peptidase"
FT                   /function="serine proteases (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99469"
FT                   /db_xref="GOA:A4F5Z5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z5"
FT                   /protein_id="CAL99469.1"
FT                   /translation="MNDKAPQKFTDLLSEKLSAKLPGKLGEKAERGPVVAVVKLHGVIT
FT                   PTPSPVSRSTISAQTTESALTRAFGHDRLSAVVLSINSPGGAPTQSALVADRIRELADE
FT                   KKVPVLAFCEDVAASGGYWLACAADEIHAHQTSMVGSVGVVSATFGFNGLLDRFGVERR
FT                   VYTAGDHKVRLDPFSPEKEDDVRWLHGLQAELHDQFQQWVRDRRGERLKGTDEELFSGE
FT                   VYSGAKALELGLVDGVGSLRGIVRRKFPDAHLVTVEPRKPLLAKLGVGSPASARLGGVG
FT                   AVVEALEHRAMWSRFGL"
     atgaacgaca aggcgccgca gaagttcacc gacctgctga gtgagaagtt gtccgcgaag        60
     ctgcccggca agctcggcga gaaggccgag cgcggtccgg tggtggcggt ggtcaagctg       120
     cacggcgtga tcacgccgac gccgtcgccg gtcagccgca gcacgatctc ggcccagacc       180
     accgagtccg ccctgacgcg cgccttcggc cacgaccggc tgtcggcggt ggtcctctcg       240
     atcaactcgc ccggcggtgc gccgacgcag tcggcgctgg tcgccgaccg catccgcgag       300
     ctggccgacg agaagaaggt gccggtgctg gccttctgcg aggacgtcgc ggcctccggc       360
     ggttactggc tggcctgcgc ggccgacgag atccacgcgc accagacctc gatggtcggc       420
     tcggtcggcg tggtgagcgc gaccttcggc ttcaacggcc tgctcgatcg cttcggcgtc       480
     gagcgccgcg tgtacaccgc gggcgaccac aaggtgcggc tcgacccgtt cagcccggag       540
     aaggaagacg acgtgcggtg gctgcacggg ctgcaggccg agctgcacga ccagttccag       600
     cagtgggttc gcgaccgccg cggcgagcgg ttgaagggca ccgacgagga gctgttctcc       660
     ggcgaggtct acagcggcgc gaaggcgctg gagctcggac tggtcgacgg tgtcggctcg       720
     ctgcgcggga tcgtgcgccg gaagttcccc gacgcgcacc tggtcaccgt ggagccgcgc       780
     aagccgctgc tggcgaagct gggcgtcggt tccccggcgt cggcccgcct cggcggagtc       840
     ggtgccgtgg tggaggcgct ggaacaccgc gcgatgtggt cgcggttcgg cctgtag          897
//

If you have problems or comments...

PBIL Back to PBIL home page