(data stored in ACNUC1104 zone)

EMBL: AM420293.PE116

AM420293.PE116       Location/Qualifiers
FT   CDS_pept        145717..146127
FT                   /transl_table=11
FT                   /locus_tag="SACE_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99471"
FT                   /db_xref="GOA:A4F5Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z7"
FT                   /protein_id="CAL99471.1"
FT                   /translation="MSRDHGFEIRARGESTRPPRRRRVVLADSKRRTRQVARTMMELEE
FT                   QTSVGEFLVRHLMKVQMRSALLLAGFALLVLLSLPALFYALPSLGDTVWFGMHVSWLVL
FT                   GVLPYPFLVLVGYLCVRVAERHERDFIHMVEQ"
     atgagccgcg accacggttt cgagatccgg gcgcgcggcg agtcgacccg tccgccgcgc        60
     aggcgccgcg tggtgctggc cgacagcaag cggcggacgc gccaggtcgc gcgcacgatg       120
     atggagctgg aggagcagac cagcgtcggc gagttcctgg tccggcacct gatgaaagtg       180
     cagatgcgca gcgctctgct gctcgccggg ttcgcgctgc tggtgctgct cagcctgccc       240
     gcgctgttct acgcgctgcc ctcgctgggt gacaccgtct ggttcggcat gcacgtgtcg       300
     tggctggtcc tcggggtgct gccgtacccg ttcctggtgc tggtcgggta cctgtgcgtg       360
     cgcgtggccg agcggcacga gcgcgacttc atccacatgg tcgagcagta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page