(data stored in SCRATCH zone)

EMBL: AM420293.PE122

AM420293.PE122       Location/Qualifiers
FT   CDS_pept        151425..152300
FT                   /transl_table=11
FT                   /locus_tag="SACE_0124"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99477"
FT                   /db_xref="GOA:A4F603"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:A4F603"
FT                   /protein_id="CAL99477.1"
FT                   /translation="MATPPGGARPRAVRRQARPYAGPPAYPAVPRWGFPALAWRWPLAL
FT                   PTGPAVDPVRRVAALYATATSTLWIIAGMGGLTAVAELWRYVLLLRSRGEALPATTLAV
FT                   SDALVVTTGVLTLVLGALAGVVVVLWALRAREAATERIGVRSARSDAQFVLGVLVPGLN
FT                   LVVAGSSLSELEHAVLVGEGARERGARPRPSRLVLVWWAAWVASLLLGWTAFLWGFRSG
FT                   TQALADGVVLHVWTNIAVVVLAVVTIRVVRYLTTLLVPADPTELPHLRVLGLRDAPAPP
FT                   RPPRPADAQR"
     gtggcgaccc cgccgggtgg cgcgcgcccg cgcgccgtcc ggcgccaggc gcgcccctac        60
     gccggtccgc ccgcctaccc ggcggtgccg cgctgggggt tcccggcgct ggcctggcgg       120
     tggccgctgg cgctgcccac cgggcccgcc gtcgacccgg tgcggcgggt ggccgcactg       180
     tatgcgacgg ccacctcgac gctgtggatc atcgcgggca tgggcggtct gaccgccgtc       240
     gccgagctct ggcgctacgt cctgctgctg cgcagccgcg gtgaggcgct gcccgcgacg       300
     accctggcgg tctccgatgc gctggtcgtc acgaccggcg tgctgaccct ggtcctcggt       360
     gcgctcgccg gagtggtcgt cgtcctgtgg gcgctgcggg cgcgcgaggc cgcgaccgag       420
     cggatcggtg tgcgcagcgc gcgttccgac gcccagttcg tgctgggcgt gctggttccc       480
     ggcctgaacc tggtcgtggc tggctcgtcg ctgagcgaac tggagcacgc cgtcctggtc       540
     ggggagggcg cccgcgagcg gggtgcccgt ccgcgcccgt cgcggctggt cctggtgtgg       600
     tgggcggcct gggtggcgag cctgctgctc ggctggaccg ccttcctgtg gggattccgc       660
     agcggcacac aggcgctggc cgacggcgtc gtgctgcacg tgtggaccaa catcgcggtg       720
     gtggtgctcg cggtggtcac catccgggtc gtccggtacc tgacgacgtt gctcgtcccg       780
     gcggacccga ccgaactgcc gcacctgcgc gtgctcggcc tccgcgacgc tccggcaccc       840
     ccgcggccgc cccggcccgc ggacgcccag cgctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page