(data stored in ACNUC1104 zone)

EMBL: AM420293.PE126

AM420293.PE126       Location/Qualifiers
FT   CDS_pept        155413..155994
FT                   /transl_table=11
FT                   /locus_tag="SACE_0128"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99481"
FT                   /db_xref="GOA:A4F607"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F607"
FT                   /protein_id="CAL99481.1"
FT                   /translation="MTAHLPAAPASAAEAARSWPGRAHQGDMAATEDDFAEFVRVALPG
FT                   LMRYGHALTGNPHDAADLVQTVLEKVGARWAKVSQNCDDPRAYVRKAMANTHVSRWRRT
FT                   RRETLIAEFPDVPAQPRHDRLEDEPVWQALQTLPPRQRAVVVLRFYEGLSEAEIADTLG
FT                   VSCGTVKSQNSKAMATLRKRLGPLVEGGDV"
     gtgaccgcgc acctgcctgc tgcacccgca tccgccgcgg aggcggcacg cagctggcct        60
     gggcgcgcgc atcaggggga catggcggcg acggaagacg acttcgcgga gttcgtccgg       120
     gtagctctac ctgggctgat gcgttacggc cacgcgctga ccggcaaccc gcacgacgcg       180
     gccgacctgg tccagaccgt cctggagaag gtcggcgcgc ggtgggcgaa ggtgagccag       240
     aactgcgacg acccgcgcgc ctacgtgcgc aaggcgatgg ccaacaccca cgtcagccgc       300
     tggcgccgca cccggcgcga gacgctgatc gcggagttcc cggacgtccc cgcccagccg       360
     aggcacgacc ggctggagga cgagccggtg tggcaggcgt tgcagacgct gccgccgagg       420
     caacgcgcgg tggtggtgct gcgtttctac gaagggcttt ccgaggccga gatcgccgac       480
     acgctcgggg tgagctgcgg aacggtcaag agccagaaca gcaaggcgat ggccacgctg       540
     cgcaagcgcc tcggaccgct ggttgaggga ggtgacgtgt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page