(data stored in ACNUC1104 zone)

EMBL: AM420293.PE128

AM420293.PE128       Location/Qualifiers
FT   CDS_pept        complement(156543..157103)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0130"
FT                   /product="ferritin family protein"
FT                   /function="Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99483"
FT                   /db_xref="GOA:A4F609"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4F609"
FT                   /protein_id="CAL99483.1"
FT                   /translation="MAITAKKIERRESKFHQLLQEQVHNEFTASQQYIAVAVWFDNEDL
FT                   PRLASHFYKQALEERNHAMMIVQYLMDNNIKPNIPGVPDVRNDFSETRELVALALEQER
FT                   EVTQEIVNLAKTAREEGDYLGEQFMQWFLKEQVEEVSQMSTLLNVVDRSNGNLFDVETF
FT                   LARETVGDEGADSGAPPAAGGTL"
     atggctatca ccgcgaagaa gattgagcgc agggaatcga agttccacca gttgctgcag        60
     gagcaggtgc acaacgagtt caccgcctcg cagcagtaca tcgcggtcgc ggtgtggttc       120
     gacaacgagg acctgcccag gctggcgtcg cacttctaca agcaggcgct ggaagagcgc       180
     aaccacgcga tgatgatcgt ccagtacctc atggacaaca acatcaagcc gaacatcccg       240
     ggcgtgcccg acgtccgcaa cgacttctcc gagacccgcg agctcgtggc gctggccctg       300
     gagcaggagc gcgaggtcac ccaggagatc gtgaacctgg ccaagaccgc ccgcgaggag       360
     ggcgactacc tcggcgagca gttcatgcag tggttcctca aggagcaggt cgaagaggtc       420
     tcccagatgt cgacgctgct caacgtggtg gaccgctcga acggcaacct gttcgacgtc       480
     gagaccttcc tggcgcgcga gaccgtgggc gacgagggcg ccgactccgg tgcgccgccg       540
     gccgcgggcg gcacgctctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page