(data stored in ACNUC1104 zone)

EMBL: AM420293.PE133

AM420293.PE133       Location/Qualifiers
FT   CDS_pept        161587..162348
FT                   /transl_table=11
FT                   /locus_tag="SACE_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99488"
FT                   /db_xref="UniProtKB/TrEMBL:A4F614"
FT                   /protein_id="CAL99488.1"
FT                   /translation="MPQAVVDHLAARSGPYAGVMGPMLCQASRLAELITELAKAKPAEP
FT                   VALSLVCDTGLGGVPKALSIIEGRQELLALRMVEMPAPSDVDDIWLERVSEFVPEDIVR
FT                   VVEPRRGANGWLDGIKRVAEHGCWPKLRCGGQTAESFPSVEVVSDFLAVASTLGVPFKV
FT                   TAGVHSAVRRTDPETGFTHHGFLNLLVATARSLSGKNVREALGSTDDAGLADEARSLSD
FT                   DAARAVRDVFASYGSASLTDPVTDLEGLELL"
     gtgccgcagg cggtcgtcga ccacctcgcg gcgcggagcg gtccgtacgc cggcgtgatg        60
     ggcccgatgc tgtgccaggc gtcccggctg gccgaactga tcaccgagct ggccaaggcc       120
     aagcccgccg agccggtggc gctgtcgctg gtctgcgaca ccggtctcgg cggggtgccg       180
     aaggcgctgt cgatcatcga gggcaggcag gagctgctcg cgctgcggat ggtggagatg       240
     cccgcgccgt ccgacgtcga cgacatctgg ctggaacggg tctcggagtt cgtgcccgag       300
     gacatcgtcc gcgtggtcga gccccgccgc ggcgccaacg gctggctcga cggcatcaaa       360
     cgggtcgccg agcacggctg ctggccgaag ctgcgctgcg gcggccagac cgcggagtcg       420
     ttcccgtcgg tcgaggtcgt ctccgacttc ctcgcggtgg ccagcacgct cggcgtcccg       480
     ttcaaggtca ccgcgggcgt gcacagcgcg gtccgccgga ccgacccgga gaccggcttc       540
     acccaccacg gcttcctcaa cctgctggtc gccaccgcgc gctcgctgtc gggcaagaat       600
     gtgcgcgaag ccctgggcag caccgacgac gccgggctcg ccgacgaggc gcgctcgctg       660
     tccgacgacg cggccagggc ggtgcgcgac gtcttcgcct cctacggctc tgcctcgctg       720
     accgatccgg tcaccgacct cgaaggattg gaactgctgt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page