(data stored in ACNUC1104 zone)

EMBL: AM420293.PE136

AM420293.PE136       Location/Qualifiers
FT   CDS_pept        complement(164289..165488)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99491"
FT                   /db_xref="GOA:A4F617"
FT                   /db_xref="UniProtKB/TrEMBL:A4F617"
FT                   /protein_id="CAL99491.1"
FT                   /translation="MTGRIIRTELVRGAGGPLALVVLAATAGVLFTNPDWAGNWNGLAM
FT                   GVRGSLLLSCPLVAMAGTWAVGRQHRRQTSELLTIAPRPRWQPFTASWLALTAGACLGL
FT                   LAGWLTGGAFVLPVATYIGLGWVATLLACVPVLGASAAFGMLVGHFVPWRLMTPVTGMV
FT                   TGLGMLWTQSSVSGGLEWLGPVAGNSWLGGTGYAATTNALHTAWFSGLALTFLAVASLR
FT                   RRILALVPAALAVAAATSLMALPQHWTTEAVAEEQVCVTNGATVCGPRYQEHLYPELAG
FT                   LARPMLDKIRGVPGAPAQITYGGAEGTTLHESTPAGTLADPADERRALAYWLASANYRC
FT                   PGQPFSEGSSAAARWLLEGIPGTEGLISGVPVRDRDWVVRYYAALESCDTPAMHELVGE
FT                   "
     atgaccggcc ggatcatccg caccgaactc gtccggggcg ccggcggccc gctcgcgctg        60
     gtcgtgctgg ccgccaccgc gggtgtgctg ttcaccaacc cggactgggc gggcaactgg       120
     aacggcctgg cgatgggcgt ccggggaagc ctcctgctct cgtgcccgct ggtggcgatg       180
     gccgggacgt gggcggtggg ccggcagcac cggcggcaga cctcggagct gctgacgatc       240
     gcaccgcgtc cgcgctggca gccgttcacc gcatcgtggc tggcgctgac cgcgggcgcc       300
     tgcctcgggc tgctggccgg gtggctcacc ggcggcgctt tcgtccttcc cgtggccacc       360
     tacatcggcc tcggctgggt cgcgacgttg ctggcctgcg taccggttct cggggcgtcg       420
     gccgcgttcg ggatgctggt cggccacttc gtgccgtggc gtctgatgac gccggtgacc       480
     ggcatggtga ccggactcgg gatgctgtgg acgcagtcgt ccgtgtcggg cgggctcgag       540
     tggctggggc ccgtggcggg gaattcgtgg ctgggcggca ccggctacgc ggctaccacc       600
     aacgcgctgc acaccgcgtg gttctccggg ctggcgctga cgttcctggc ggtcgcctcg       660
     ctgcggcgca ggatcctggc gctggtgccc gccgcgctcg cggtggcggc ggcgacgtcg       720
     ctcatggcgc tgccccagca ctggaccacc gaagcggtcg ccgaggaaca ggtgtgcgtc       780
     accaacggcg ccaccgtttg cgggcctcgg taccaggaac acctctaccc ggaactggcg       840
     ggcctcgcgc gaccgatgct cgacaagatc cggggtgttc ccggcgcacc ggcgcagatc       900
     acctacggcg gcgcggaggg cacgacgctg cacgaatcga cgcccgcagg aaccctcgcc       960
     gaccccgcgg acgaacgccg ggcgctggcc tactggctgg ccagtgccaa ctaccgctgt      1020
     ccgggacagc ccttctccga aggctcgtcc gccgctgccc gttggctgct cgaaggcatc      1080
     ccgggcaccg aaggcctcat ctccggcgtt cccgttcgcg accgggactg ggtggtcagg      1140
     tactacgcgg ccctggaaag ctgcgacacc cccgccatgc acgagttggt gggcgagtag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page