(data stored in SCRATCH zone)

EMBL: AM420293.PE139

AM420293.PE139       Location/Qualifiers
FT   CDS_pept        complement(167019..167516)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0141"
FT                   /product="ECF subfamily sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99494"
FT                   /db_xref="GOA:A4F620"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F620"
FT                   /protein_id="CAL99494.1"
FT                   /translation="MARGNRSAFDQLYQRNAGWIAARLRRRCEDPELAAEVLQECFLTV
FT                   WRSAGGFDPRKNAAAWLWTVASSRLVDAHRRRQARVRTTGEPHESALTSASAEAEYMRS
FT                   TLSPELADAVHRLPPELHAVLKATVLDGMTVRETAALLGIPEGTVKTRARKARHILREA
FT                   LA"
     gtggcgcgcg gcaaccgctc cgccttcgac cagctctacc agcgcaacgc gggctggatc        60
     gcggcgcggt tgcgccgccg ctgcgaggac ccggagctgg ccgccgaggt gctccaggag       120
     tgcttcctga ccgtgtggcg ctcggcaggc gggttcgacc cccgcaagaa cgccgcggcg       180
     tggctgtgga ccgtcgcgtc cagcaggctg gtcgacgcgc accgccgtcg ccaggcgcgg       240
     gtccggacca ccggtgagcc ccacgagtcg gcgctcacct cggcgtcggc cgaagcggag       300
     tacatgcgtt cgacgctcag cccggagctg gccgacgcgg tgcaccggct gcctcccgaa       360
     ctgcacgcgg tgctgaaggc gaccgtcctc gacggcatga cggtccggga gaccgcggcg       420
     ctgctcggca tcccggaagg aaccgtcaag acccgcgccc gcaaagcccg ccacatcctc       480
     agggaggcac tcgcatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page