(data stored in SCRATCH zone)

EMBL: AM420293.PE14

AM420293.PE14        Location/Qualifiers
FT   CDS_pept        22287..25007
FT                   /transl_table=11
FT                   /locus_tag="SACE_0016"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99369"
FT                   /db_xref="GOA:A4F5P5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P5"
FT                   /protein_id="CAL99369.1"
FT                   /translation="MHGRERERRAIRSILEDARSARGRALVLRGETGIGKSTLLKYAQR
FT                   RAAGMRLLSCSGLESESELAFSGLQHLVAPLLDEIDGLPPSQAEALRAALGMSELPVTE
FT                   FVVSAAVCSLLSYSARGTPLLVVVDDAQWLDRATLGALYFTARRIATEPIALLFGMGEA
FT                   EQHEREARDLPTMLLTGLSDEAADDLLDELGWNAPARDSLITATGGNPLALRELTRLGA
FT                   PEQLVGDALLLGTVPLSERLRTAFIQRMEGLPAKARALLLVVAVEETGRLGVVLGACAR
FT                   LGIDAGVLDSVLRGYDQLEITERWVRFRHSLMRSAAYHKASLRMRSKAHAAVAEELTDR
FT                   GESDRASWHRAMAAVEPDEELATALERSADTAERRGGSAAVVSVLQRAAKLSTDPEGRT
FT                   RRTASAAYAAWQSGQPDLARALTTEVMTAPTDMHARVGLTRLLGLIDLDSNDPAVACAQ
FT                   FVRGAQEVAEHNPEEALTLLFLAVDGGYLSGRIEDAGRAARLMTELDCGPDYRLLAERM
FT                   CAALEGRLPLEGTTPRELLDAAPALPTPDDEIRFLWVMAMSWLGPHQRQAREFGLAACR
FT                   TFRLKGVASVLPVMLNWVADTEYHLGLWRDGQAHAEEAVRLARDTGQRNRMADGLALLA
FT                   RFASVRGDWDGCRDHADAALETALVLRNRAAAAHVSWALGLADLARGRDADAYRRLSSI
FT                   RSEGSPYANSKVAALVHPDLVEAAVRCGHSDIAEVLLSEVREGCRGTTARWRKLHLHMC
FT                   RALVEESGADFATATGADLGEDRPFDRARAALLHGEWLRRNRRQAEARWQLQQAAELFD
FT                   SLGAAPWSERARGQLRAARGALLRTADPAVLTRQEKQIAGMAATGMTNKEIAAQLSVSP
FT                   RTVSHHLYKLFPKLGISSRAQLRGLDLESAPTQDG"
     ttgcacgggc gcgaacgcga acgccgcgcg atccggtcga ttctggagga cgcgaggtcg        60
     gcgagaggcc gcgcactggt gctccggggt gaaaccggga tcggcaagag cacgctgctg       120
     aagtacgcgc aacgccgggc cgcgggaatg cggctgctgt cctgctccgg actggaatcg       180
     gagtccgagc tcgcgttctc cgggttgcag cacctggtcg ctccgctgct cgacgagatc       240
     gacgggctgc cgccgtcgca ggccgaggcg ctgcgcgcgg cgctggggat gtccgaactg       300
     ccggtgaccg agttcgtggt gtcggcggcg gtgtgctcgc tgctgtcgta ctccgcgcgc       360
     ggaacaccgc tgctcgtcgt cgtcgacgac gcgcaatggc tggaccgggc cacgctcggc       420
     gcgctgtact tcaccgcccg ccggatcgcg accgaaccga tcgcgctgct gttcggcatg       480
     ggcgaggccg agcagcacga gcgggaggcc cgcgatctgc ccaccatgct gctgaccgga       540
     ctgtccgacg aagccgccga cgacctgctc gacgagctgg gctggaacgc accggcccgc       600
     gactcgctga tcaccgcgac cggaggcaac ccgctcgcgc tgcgggagct gacccggctc       660
     ggagccccgg agcagctcgt cggggacgcg ctgctgctgg gcaccgtgcc gttgagcgag       720
     cgcctgcgga cggcgttcat ccagcggatg gaggggctgc ctgccaaggc ccgggcgctg       780
     ctgctggtgg tggccgtcga ggagaccggc aggctcggcg tggtgctcgg cgcctgcgcc       840
     cgcctgggca tcgacgccgg ggtgctggac tcggtgctca ggggctacga ccagctcgag       900
     atcaccgaac gctgggtgcg cttccgccat tcgctgatgc ggtcggcggc ctaccacaag       960
     gcgtcgctgc ggatgcggtc gaaggcgcac gccgcggtgg ccgaggagct gaccgaccgc      1020
     ggtgagtccg accgggcgtc ctggcaccgg gcgatggcgg cggtcgaacc ggacgaggag      1080
     ctcgccacgg cgttggagcg cagcgccgac accgccgagc ggcgcggcgg cagcgccgcg      1140
     gtggtgtcgg tcctgcagcg cgcggccaag ctgagcaccg atccggaggg gcggacgcgg      1200
     cgcaccgcct cggccgcgta cgcggcgtgg cagtccggcc agcccgacct cgccagggcg      1260
     ctgacgaccg aggtcatgac cgcaccgacg gacatgcacg ccagggtggg gctgacgcgt      1320
     ctgctgggcc tgatcgacct ggacagcaac gacccggcgg tggcgtgcgc gcagttcgtc      1380
     cggggtgccc aggaggtcgc cgagcacaac ccggaggagg cgctgaccct gctcttcctc      1440
     gccgtggacg gcggttacct gtcggggcgg atcgaggacg cgggccgggc cgcgcggctg      1500
     atgaccgaac tggactgcgg gccggactac cggctgctcg ccgagcggat gtgcgccgcg      1560
     ctcgaagggc gcctgccgtt ggagggcacc accccgcgcg agctgctcga tgccgcaccc      1620
     gccctgccca cgcccgacga cgagatccgg ttcctgtggg tgatggcgat gagctggctc      1680
     ggtccgcacc agcgccaggc cagggagttc gggctcgcgg cctgccggac gttccggctc      1740
     aagggcgtgg ccagcgtcct gcccgtgatg ctgaactggg tggccgacac cgagtaccac      1800
     ctggggctgt ggcgcgacgg gcaggcgcac gccgaggagg cggtgcggct ggcccgcgac      1860
     accgggcagc gcaaccggat ggccgacggc ctggcgctgc tcgcccggtt cgcctccgtg      1920
     cggggcgact gggacgggtg ccgggaccac gccgacgccg cgctggagac ggcgctggtg      1980
     ttgcgcaacc gtgccgccgc ggcgcacgtg agctgggcgc tgggtctggc ggacctggcc      2040
     aggggacggg acgccgacgc gtaccggcgg ttgtcgtcga tcaggtcgga gggatcgccg      2100
     tacgccaaca gcaaggtcgc ggcgctggtc caccccgacc tcgtcgaagc ggcggtccga      2160
     tgtggacatt cggacatcgc cgaggtgctg ctttccgagg tgcgggaagg ctgccgcggg      2220
     acgacggcgc ggtggcggaa gctgcacctg cacatgtgcc gggccctggt cgaggagtcc      2280
     ggtgccgact tcgccaccgc caccggcgcc gacctgggtg aggaccgccc tttcgaccgc      2340
     gcccgcgcgg ccctgctgca cggcgagtgg ctgcgtcgca accggcgcca ggccgaggcc      2400
     cgctggcagt tgcagcaggc ggcggagctg ttcgacagcc tcggtgcggc gccctggtcc      2460
     gaacgtgccc gcggccagtt gcgcgcggct cggggagcgc tgctgcgcac cgccgacccg      2520
     gccgtgctga ccaggcagga gaagcagata gcaggcatgg ccgccaccgg catgaccaac      2580
     aaggagatcg ccgcgcagct ctcggtcagc ccacgcacgg tcagccacca cctgtacaag      2640
     ctcttcccga agctggggat ctcctcgcgc gcccagttgc ggggcctcga cctggagtcg      2700
     gcccccaccc aggacggctg a                                                2721
//

If you have problems or comments...

PBIL Back to PBIL home page