(data stored in ACNUC1104 zone)

EMBL: AM420293.PE140

AM420293.PE140       Location/Qualifiers
FT   CDS_pept        167948..169483
FT                   /transl_table=11
FT                   /locus_tag="SACE_0142"
FT                   /product="putative cytochrome ubiquinol oxidase subunit"
FT                   /function="Cytochrome bd-type quinol oxidase, subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99495"
FT                   /db_xref="GOA:A4F621"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A4F621"
FT                   /protein_id="CAL99495.1"
FT                   /translation="MDLLDIARWQFGITTVYHFLMVPLTIGLSILVAGMQTAWYRTGDR
FT                   RYLKMTKFWGKLMLINFAMGVVTGIVQEFQFGMSWSAYSRFVGDVFGAPLAMEGLVAFF
FT                   VESTFLGLWIFGWDRLSKGVHLACAWAFSLATVASAYFILAANSWMQHPVGIVFTDGRP
FT                   RLDSIWAVLTNNTVLAAFPHTVFGCFAVAGAFLVGISAWQIWKHHRDTVGKNPGLERRT
FT                   EEQNEDRKVWHGSLRLGAWVGVIAFAGLAISGDLQAKLMFEQQPMKMASAEALCHTEQP
FT                   AGFSIFAIGDVGQSNCEDVKSLTVPYLLSYLANGDLHSEVRGVQQLIGEYQAAYGSHYP
FT                   DDPRLGPYAGKPVDYVPNLPVTYWGFRFMIGFGAVAAAGAVVVLWLTRKGRYPKWRWWT
FT                   PLAVLSIATPYLGNSFGWIFTEMGRQPFVVAPNPNPSGVDGVFMYTATAVSSGVTPGEM
FT                   LTSLIGLTSIYGVLAVVEIFLIVRYVRGGIAGVLPPEPPEGKKESDEALSFAY"
     gtggacctgc tcgacatcgc acgctggcag ttcggcatca cgaccgtcta ccacttcctg        60
     atggtgccgt tgaccatcgg gctttccatc ctggtcgcgg ggatgcagac ggcgtggtac       120
     cgcaccggtg accgtcggta cctcaagatg accaagttct ggggcaagtt gatgctgatc       180
     aacttcgcca tgggcgtggt caccggcatc gtccaggagt tccagttcgg catgtcctgg       240
     agcgcctact cgcggttcgt cggcgacgtc ttcggcgctc cgctggcgat ggagggcctg       300
     gtcgcgttct tcgtcgagtc caccttcctg gggttgtgga tcttcggctg ggaccggctg       360
     tccaagggcg tgcacctggc gtgcgcgtgg gcgttctcgc tggccaccgt cgcgtcggcg       420
     tatttcatcc tggccgccaa ctcgtggatg caacacccgg tgggcatcgt gttcaccgac       480
     ggcaggccgc ggctggactc gatctgggcg gtgctgacca acaacaccgt gctggcggcg       540
     ttcccgcaca ccgtgttcgg ctgcttcgcc gtggccggcg ccttcctggt cggcatctcg       600
     gcctggcaga tctggaagca ccaccgcgac accgtcggca agaaccccgg cctggagcgc       660
     cgcaccgaag agcagaacga ggaccgcaag gtctggcacg gctcgctgcg gctcggcgcg       720
     tgggtcggcg tgatcgcctt cgcgggactg gcgatttccg gtgacctgca ggcgaagctg       780
     atgttcgagc agcagccgat gaagatggcc tccgccgagg cgctgtgcca caccgagcag       840
     cccgccggct tctcgatctt cgcgatcggc gacgtcggcc agtccaactg cgaggacgtc       900
     aagagcctca cggtgcccta cctgctgtcg tacctggcca acggcgacct ccacagcgag       960
     gtcaggggcg tgcagcagct catcggcgag taccaggccg catacggctc gcactacccg      1020
     gacgacccga ggctcggccc ctacgcgggc aagcccgtcg actacgtgcc gaacctgccg      1080
     gtcacctact ggggcttccg gttcatgatc ggcttcgggg cggtcgccgc cgccggcgcg      1140
     gtcgtggtgc tgtggctgac ccgcaagggc cggtacccga agtggcgctg gtggacgccg      1200
     ctggccgtgc tcagcatcgc caccccgtac ctgggcaaca gcttcggctg gatcttcacc      1260
     gagatgggca ggcagccgtt cgtggtggcg cccaacccga acccgtccgg tgtcgacggc      1320
     gtgttcatgt acaccgcgac ggcggtgtcc tccggcgtga caccgggcga gatgctgacc      1380
     tcgctgatcg gcctgacctc gatctacggc gtgctggcgg tcgtcgagat cttcctgatc      1440
     gtgcgctacg tgcgcggcgg catcgcgggt gtgctgccac cggaaccgcc ggaggggaag      1500
     aaggagtccg atgaagccct gtcgttcgcg tactga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page