(data stored in ACNUC1104 zone)

EMBL: AM420293.PE143

AM420293.PE143       Location/Qualifiers
FT   CDS_pept        174238..175386
FT                   /transl_table=11
FT                   /locus_tag="SACE_0145"
FT                   /product="two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99498"
FT                   /db_xref="GOA:A4F624"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F624"
FT                   /protein_id="CAL99498.1"
FT                   /translation="MDSTLARQMLAASTEITTVALSAEDPETVLPMVVRKAAALAEADL
FT                   CLVMVRGDDGRLTVEAAYGGPSSTVPLADPVGAVLSTRSAAARVARSGVAVVVDDVIDD
FT                   PITAPYVPAALRVYGPFAAAPFGTRERRLGALAVYRRRGASTFTRVAVDVLTAFAAQAG
FT                   MALVLAEGSTARQRIAVYQERERIARDLHDVIVQRLYAAGVQLEVLERRLDGRLDTPDA
FT                   RRLAETMDQIDQTIAEVRATVRTLTSADPGTPAQAPDLAESMRSEVRIAGELLGRPPKL
FT                   DIEGDLSDVPVAVADHARAALREALSNVVRHSGARSVLVRVRRTPYGLLLQVVDDGCGV
FT                   PRDVSKRGLRNLEERATAAGGRCVITSSPDSGTTVTWEVPLG"
     atggactcga cccttgccag gcagatgctc gcggcgtcga cggagatcac caccgtcgcg        60
     ttgtcggccg aggacccgga gaccgtcctg ccgatggtcg tccgcaaggc cgccgcgctc       120
     gccgaagccg acctgtgcct ggtgatggtc cggggcgacg acggcaggct caccgtcgag       180
     gccgcctacg gcggtccgtc ctcgaccgtg ccgctggccg acccggtcgg cgcggtgctg       240
     tccacccgct cggcggccgc ccgcgtcgcc cgcagcggcg tggccgtcgt cgtcgacgac       300
     gtcatcgacg accccatcac cgcgccgtac gtgcccgccg cgctgcgggt ctacggcccg       360
     ttcgcggcgg cgccgttcgg tacccgcgag cggcgcctgg gcgcgctggc ggtctaccgc       420
     aggcgcggcg ccagcacgtt caccagggtc gcggtcgacg tgctgaccgc gttcgccgcg       480
     caggcgggca tggcgctggt actcgccgag ggctcgaccg cgcgccagcg catcgccgtc       540
     taccaggagc gcgagcgcat cgcccgcgac ctgcacgacg tgatcgtgca gcggctgtac       600
     gcggcgggcg tgcagctgga ggtcctggag cggcggctcg acggcaggct cgacaccccc       660
     gacgccaggc ggctggccga gacgatggac cagatcgacc agacgatcgc cgaggtccgg       720
     gccaccgtgc ggacgctgac ctcggccgat ccgggcaccc cggcgcaggc gccggacctc       780
     gccgagtcga tgcgctcgga ggtccgcatc gccggtgagc tgctgggcag gccgccgaag       840
     ctggacatcg agggcgacct ctccgacgtg ccggtcgcgg tggccgacca cgcccgcgcc       900
     gcgctgcgcg aggcgctgtc gaacgtggtc cgccactccg gggcgcgcag cgtcctggtc       960
     cgcgtccgcc gcacgcccta cggcctgctg ctccaggtcg tcgacgacgg ctgcggcgtg      1020
     ccccgcgacg tctccaagcg cggcctgcgc aacctggagg agcgcgccac ggcggccggg      1080
     ggccgctgtg tgatcacctc gtccccggac agcggcacca cggtcacctg ggaagtgccg      1140
     ctgggctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page