(data stored in ACNUC1104 zone)

EMBL: AM420293.PE145

AM420293.PE145       Location/Qualifiers
FT   CDS_pept        complement(176842..177477)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0148"
FT                   /product="two-component system response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99500"
FT                   /db_xref="GOA:A4F626"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4F626"
FT                   /protein_id="CAL99500.1"
FT                   /translation="MRVLLVDDHEVVRRGLRDLLDTEDDVEIVAEAGGVDEALVRARSV
FT                   EPDVAVVDMRLPDGDGLELCRRLRALDPAPYCLVLTAFDDEQALVGAINAGASGYLLKQ
FT                   VRGQDLVNAVREVAAGRSLLDPVTTARVLDRLRQSTSPVPDELDALTERERKVLELIGE
FT                   GLTNRQIAERLFLAEKTVKNYVTAVLAKLGMERRTQAAAWVARRQSHT"
     gtgcgggtac tgcttgtcga tgatcacgag gtcgttcgcc gcggcctgcg cgacctgctg        60
     gacaccgagg acgacgtcga gatcgtcgcc gaggcgggcg gggtcgacga ggcgctggtc       120
     cgcgcccgca gcgtcgaacc ggacgtcgcg gtcgtggaca tgcggctccc cgacggagac       180
     ggcctggagc tgtgccgtcg gctgcgcgcc ctcgaccccg ccccctactg cctggtgctg       240
     accgcgttcg acgacgagca ggcgctggtc ggcgcgatca acgccggcgc gtcgggctac       300
     ctgctcaaac aggtgcgcgg gcaggacctg gtcaacgccg tgcgggaggt ggccgcgggc       360
     cgttcgctgc tcgacccggt caccaccgcg cgggtgcttg accgcctgcg ccagtccacc       420
     agccccgtcc cggacgagct cgacgcgctc accgagcgcg agcgcaaggt gctggagctg       480
     atcggcgagg gcctgaccaa ccggcagatc gcagagcggc tgttcctggc ggagaagacg       540
     gtcaagaact acgtcacggc ggtgctggcc aaactcggca tggagcgccg cacgcaggcc       600
     gcggcgtggg tggcgcggcg gcagagccac acctag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page