(data stored in ACNUC1104 zone)

EMBL: AM420293.PE146

AM420293.PE146       Location/Qualifiers
FT   CDS_pept        complement(177540..178079)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0149"
FT                   /product="DoxX"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99501"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4F627"
FT                   /protein_id="CAL99501.1"
FT                   /translation="MLIRRLARPLLATTFIYGGVQALRDVPSHAKAASPLLEKTTGKVR
FT                   DSLPEQVPTDPETLVRIDAMVKIGAGTMLALGKFPRLASLLLAGSVVPTTLAGHPFWEI
FT                   SDPEQRQSQQIHFYKNLGLLGGLLISAVDTGGKPSVGYRARHTAQRARHTAHKVSEQTH
FT                   QAVGTGKGKGRKKRRK"
     atgctcatcc gccgtttggc ccgcccgctg ctggcgacga cgttcatcta cggcggcgtg        60
     caggcgcttc gcgatgtgcc cagccacgcc aaggccgcga gtccactgct ggagaagacc       120
     acgggcaagg tccgcgactc gctgcccgag caggtgccca ccgatcccga gacgctggtc       180
     cgcatcgacg cgatggtgaa gatcggcgcc ggcacgatgc tggcgctggg caagttcccc       240
     cgcctggcct cgctgctgct ggcgggcagc gtcgtgccca cgacgctggc cgggcacccg       300
     ttctgggaga tctccgaccc tgagcagcgc cagagccagc agatccactt ctacaagaac       360
     ctcgggctgc tcggcggcct gctgatctcg gccgtcgaca ccgggggcaa gccgtcggtc       420
     ggctaccgcg cgcgccacac ggcgcagcgt gcacgccaca cggcgcacaa ggtctccgag       480
     caaacgcacc aggcggtcgg caccgggaag ggcaaggggc gcaagaagcg caggaagtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page