(data stored in ACNUC1104 zone)

EMBL: AM420293.PE147

AM420293.PE147       Location/Qualifiers
FT   CDS_pept        178272..178754
FT                   /transl_table=11
FT                   /locus_tag="SACE_0150"
FT                   /product="heat shock protein HSP20"
FT                   /function="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99502"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A4F628"
FT                   /protein_id="CAL99502.1"
FT                   /translation="MTLVRRSSWDPFGNLVRQMDRDFDSISRRFFGSQGVEGFVPATNV
FT                   ERDGSDVVIKLELPGVDIAQDVEVEVTDGRLSISGQRRTEKTSGEDGAVLLREIRTGAF
FT                   RREFNLPEGVTAEQVEANYDRGVLEVRVHEVSKPAPAPTKIQIADRRQGDGKAELN"
     atgactctgg ttcgcaggtc gagctgggac ccgttcggca acctggtccg ccagatggac        60
     cgcgacttcg acagcatcag ccgccggttc ttcggcagcc agggcgtcga gggcttcgtc       120
     ccggccacca acgtcgagcg cgacggttcg gacgtggtga tcaagctgga gctgccgggc       180
     gtggacatcg cccaggacgt cgaggtggag gtcaccgacg gccggctgtc gatcagcgga       240
     cagcgccgca ccgagaagac cagcggtgag gacggcgcgg tgctgctgcg cgagatccgc       300
     accggtgcgt tccggcggga gttcaacctg ccggagggcg tgacggccga gcaggtcgag       360
     gcgaactacg accgcggggt gctcgaggtg cgggtgcacg aggtcagcaa gcccgcgccc       420
     gccccgacca agatccagat cgccgaccgg cgccagggcg acggcaaggc cgagctgaac       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page