(data stored in ACNUC1104 zone)

EMBL: AM420293.PE154

AM420293.PE154       Location/Qualifiers
FT   CDS_pept        183493..184662
FT                   /transl_table=11
FT                   /locus_tag="SACE_0157"
FT                   /product="hypothetical protein"
FT                   /function="Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99509"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4F635"
FT                   /protein_id="CAL99509.1"
FT                   /translation="MRRRTTQRRPDWQSKVEELGLVFGTPARAADGSQRPYWDEGVHYE
FT                   FGLDEVLSLEADVELLHSMCLDAVDHVVTTERYRDFGIPEWVWPHIAESWKRHDPHLYG
FT                   RFDLRYDGSGPARLLEYNADTPTSLLEAAVVQWHWLTEVHEGDDQWNSIHEKLVERWEE
FT                   IGKQLGTNEVHFTWSGSDSTGEDNLTAAYLQETAAEAGLDTVGLAIEEIGWDSLLERFV
FT                   DLEEAPMSSVVKIYPWEWMVDDDFGTHAVKTLPQTQWIEPLWKMLLSNKALLAILWEMH
FT                   PGHPNLLPAYIGQPGLLTEYVRKPLLGREGNNISIVAPGWETETGGFYGEEGYVYQAFD
FT                   PLPEFDGMRPALGAWVVGDSSAGLGIRETAGLITDDGAAFVPHRIPDGS"
     gtgcggcgca ggacaacgca gcggcggccg gactggcagt cgaaggtcga ggagctgggg        60
     ctggtcttcg gcacgcccgc gcgtgccgcg gacggctccc agcggcccta ctgggacgag       120
     ggcgtccact acgagttcgg cctcgacgag gtgctctcgc tggaggccga cgtcgagctg       180
     ctgcactcga tgtgcctgga cgcggtcgac cacgtggtca ccaccgagcg ctaccgcgac       240
     ttcggcatcc cggagtgggt gtggccgcac atcgccgagt cgtggaagcg ccacgacccg       300
     cacctctacg gccgcttcga cctgcgctac gacgggtccg gcccggccag gctgctggag       360
     tacaacgccg acacgccgac ctcgctgctg gaggccgcgg tcgtgcagtg gcactggctg       420
     accgaggtcc acgagggcga cgaccagtgg aactccatcc acgagaagct ggtcgagcgc       480
     tgggaggaga tcggcaagca gctcggcacc aacgaggtgc acttcacctg gtcgggttcg       540
     gattccaccg gcgaggacaa cctcaccgcc gcctacctgc aggagaccgc cgccgaggcg       600
     ggcctggaca ccgtcgggct ggcgatcgag gagatcggct gggacagcct gctggagcgc       660
     ttcgtcgacc tcgaagaggc gccgatgagc tcggtcgtca agatctaccc ctgggagtgg       720
     atggtcgacg acgacttcgg cacccacgcg gtgaagacgc tgccgcagac gcagtggatc       780
     gagccgctgt ggaagatgct gctgtccaac aaggcgctgc tggcgatcct ctgggagatg       840
     cacccgggcc acccgaacct gctgcccgcc tacatcggcc agcccgggct gctcaccgag       900
     tacgtgcgca agccgctgct gggccgcgag ggcaacaaca tctccatcgt cgcgccgggc       960
     tgggagaccg agaccggcgg cttctacggc gaggagggct acgtctacca ggcgttcgac      1020
     ccgctgcccg agttcgacgg gatgcggccg gcgctgggcg cctgggtcgt cggcgactcc      1080
     tcggccgggc tcggcatccg cgagacggcc ggtctgatca ccgacgacgg cgccgcgttc      1140
     gtcccgcacc gcatccccga cgggagctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page