(data stored in ACNUC1104 zone)

EMBL: AM420293.PE161

AM420293.PE161       Location/Qualifiers
FT   CDS_pept        complement(190310..191563)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99516"
FT                   /db_xref="GOA:A4F642"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A4F642"
FT                   /protein_id="CAL99516.1"
FT                   /translation="MTRTRERYLLATAIVLQVLSIWFVHWIDTRGYMDTDIYRLGARAW
FT                   LTGHEVYGDDLTPESPDSGTLPFIYPPFAAILFTPLTWMSSDAAVVTVAVCSHLALLLT
FT                   AYSLARSSTYLANRAGQVAVVTAVLMPLLTLIEPTRETLNYGQINLVLMALVAADCLLP
FT                   RTRWPRGLLVGIAAAIKLTPLGFLLLFLLRRDFRAAAVAGVTFAATVLLGLLAAPDDSA
FT                   DWWLDKMLSTGDSLGTVYAGNLTLRSLLAKQELTGLPLNVLWVAGSLVLLALAVLGIRY
FT                   ALRVRNVPLALMVNAVLVLLVSPISWSHHWVWAGPVLALLFAMSVRHRWYGVLLSTGLG
FT                   ALTVLVGPQWFLPNTDDRELDWTFSQQIVGNAYTLLGIAFLIAAAVAHFRMHPPIHRPP
FT                   EAARHEPAPSHGRPNLPA"
     gtgacccgca cgcgcgagcg ctacctgctg gccacggcga tcgtcctcca ggtcctgtcg        60
     atctggttcg tgcactggat cgacacccgc ggctacatgg acaccgacat ctaccggctc       120
     ggtgcccgcg cgtggctgac cggccacgag gtgtacggcg acgacctcac gcccgagagc       180
     cccgactccg gcacgctgcc gttcatctac ccgccgttcg cggcgatcct gttcaccccg       240
     ctgacctgga tgtcctcgga cgcggcggtg gtgaccgtcg cggtgtgctc gcacctggcg       300
     ctcctgctca cggcgtactc gctcgcgcgt tcgtcgacct acctggccaa ccgcgccggg       360
     caggtcgccg tggtgaccgc cgtgctgatg ccgttgctca cgctgatcga gccgacccgg       420
     gaaacgctca actacggcca gatcaacctg gtgctgatgg cgctggtcgc cgcggactgc       480
     ctgctgccgc gcacccggtg gccgcgcggt ctgctcgtgg gcatcgcggc ggcgatcaag       540
     ctgaccccgc tgggcttcct gctgctgttc ctgctgcgcc gggacttccg cgccgccgcg       600
     gtggcaggcg tcaccttcgc cgcgaccgtg ctgctggggc tgctggccgc gcccgacgac       660
     tccgccgact ggtggctgga caagatgctg tccaccggcg actccctggg caccgtctac       720
     gcgggcaacc tcaccctgcg cagcctgctg gccaagcagg agctgaccgg gctcccgctg       780
     aacgtgctgt gggtcgccgg gtcgctggtg ctgctggcgc tggccgtgct cggcatccgc       840
     tacgccctgc gggtgcgcaa cgtgccgctg gcgctgatgg tcaacgcggt cctggtgctg       900
     ctggtctcgc cgatctcgtg gtcgcaccac tgggtgtggg ccggaccggt gctggcgctg       960
     ctgttcgcga tgtcggtgcg ccaccgctgg tacggggtgc tgctgtcgac cgggctcggc      1020
     gcgctgaccg tgctggtcgg cccgcagtgg ttcctgccca acaccgacga ccgagagctg      1080
     gactggacgt tctcgcagca gatcgtcggc aacgcctaca cgctgctggg catcgcgttc      1140
     ctgatcgcgg cggcggtggc gcacttccgc atgcacccgc cgatccaccg gccgccggaa      1200
     gcggccaggc acgagcccgc gccgtcacac ggccgaccca acctgcccgc gtag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page