(data stored in SCRATCH zone)

EMBL: AM420293.PE166

AM420293.PE166       Location/Qualifiers
FT   CDS_pept        complement(196982..197176)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99521"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F647"
FT                   /protein_id="CAL99521.1"
FT                   /translation="MSLTWRKSSRSGSGPSNCVELAIEDLRTHIRDTKDRDGGTLRVSR
FT                   RAWASFLGEVKSGGLDLRR"
     atgagcctga cgtggcgcaa gagcagccga agcggaagcg gaccaagcaa ctgcgttgag        60
     ctggcgatcg aggacttacg gacccacatc cgcgacacca aggacaggga cgggggcacg       120
     ctgcgcgtga gtcgccgggc gtgggcgagc ttcctcggtg aggtcaagag cggcgggctg       180
     gacctgcgcc gctag                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page