(data stored in ACNUC1104 zone)

EMBL: AM420293.PE169

AM420293.PE169       Location/Qualifiers
FT   CDS_pept        complement(198779..199438)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99524"
FT                   /db_xref="GOA:A4F650"
FT                   /db_xref="UniProtKB/TrEMBL:A4F650"
FT                   /protein_id="CAL99524.1"
FT                   /translation="MTLPQTQPASPVRKFLKIFGGLLVDVGLPMAAYYGLRSYGFSEHV
FT                   SLLAGAGVAGARLLFVAFRAGKLEPFAGFMLLTYLLALPLVLVSGDDRTLVIKDSLGTG
FT                   ITGLIFLASCFFGKPAMFHAARRFRSAGDDVEAWEGLWETNPGFRRSFIFMTAVWAVVL
FT                   LAEAALRVGLAFVLPIDVMVALSAVLGMGTIALLLTWTMIYGARRQRRLKQAAHAG"
     gtgaccctgc ctcagacgca gccggcctcg ccggtccgga agttcctgaa gatcttcggc        60
     ggactgctgg tggacgtggg tctgcccatg gccgcctact acggcctgcg ctcctacggc       120
     ttcagcgagc acgtgtcgtt gctcgccgga gccggggtgg ccggggcgcg gctgctgttc       180
     gtcgctttcc gggccgggaa gctcgagccc ttcgcgggct tcatgctgct gacgtacctg       240
     ctcgcgctcc cgctcgtcct ggtctccggg gacgaccgca ccctcgtcat caaggactcg       300
     ctgggaaccg gcatcaccgg cctgatcttc ctcgcgagct gcttcttcgg taagcccgcg       360
     atgttccacg ccgcgaggcg gttccgctcc gccggcgacg acgtcgaggc gtgggagggc       420
     ctctgggaaa cgaacccggg cttccgccgc agcttcatct tcatgaccgc ggtgtgggcg       480
     gtcgtgctgc tcgccgaagc ggccctgcgc gtcggcctcg ccttcgtgct gcccatcgac       540
     gtgatggtcg cgttgtccgc ggtgctcggc atgggaacga tcgcactgct gctgacctgg       600
     acgatgatct acggggcccg gcggcaacgg cgcctcaagc aggccgcgca cgccggatga       660
//

If you have problems or comments...

PBIL Back to PBIL home page