(data stored in ACNUC1104 zone)

EMBL: AM420293.PE177

AM420293.PE177       Location/Qualifiers
FT   CDS_pept        212240..213247
FT                   /transl_table=11
FT                   /locus_tag="SACE_0180"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99532"
FT                   /db_xref="GOA:A4F658"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4F658"
FT                   /protein_id="CAL99532.1"
FT                   /translation="MAEAISHSVRVPVPQQQAAEEGSPSLVSYVLPVYNEVEGIRRFHE
FT                   ELTAVVATRPEFRYEFVYVNDGSVDGSLGILRDLAKNDSRVHVVDFARNFGHQIAITAG
FT                   LDHAAGDAVIIMDTDLQDPPRVSLELIDAWLSGAEIVSARRRTRQDSRFKRFTAHGYYR
FT                   LLRHCAEVDIPVDTGDFRLLDRRAAEELRGFRERSRFIRGMVASMGFQQAEVLFDRDER
FT                   VAGETKYPMRKMLRLAADGVTSFSTVPLRLITRIGFVSLALALLGIVYAVALRVFLPEV
FT                   TVSGWTMLMVAMLFLGGVQMLSLGVIGSYVGRIYNEVQQRPLYIVRKVIRYDQD"
     atggccgagg cgatcagtca ctctgtccga gttccggtgc cgcaacaaca agccgcggaa        60
     gagggcagcc cttcgctggt ctcgtacgtg ctgccggtct acaacgaggt ggagggcatc       120
     cgcaggttcc acgaagagct gaccgcggtg gtcgcgacgc ggccggagtt ccgctacgag       180
     ttcgtctacg tcaacgacgg ttcggtcgac ggttcgctgg gaatcctgcg cgacctcgcg       240
     aaaaacgatt cacgggtgca cgtcgtcgac ttcgcccgca acttcgggca ccagatcgcg       300
     atcaccgcgg gcctggacca cgcggcgggg gacgcggtga tcatcatgga caccgacctg       360
     caggacccgc cgcgggtcag cctggagctg atcgacgcgt ggctgtccgg tgccgagatc       420
     gtctcggccc gcaggcgcac ccggcaggac agcaggttca agcggttcac cgcgcacggc       480
     tactaccggc tgctgcgcca ctgcgccgag gtcgacatcc cggtcgacac cggcgacttc       540
     cggctgctcg accggcgggc cgccgaggag ctgcgcggtt tccgggaacg cagccgcttc       600
     atccgcggca tggtcgcgtc gatggggttc cagcaggccg aggtgctctt cgaccgcgac       660
     gagcgcgtcg ccggcgagac gaagtacccg atgcgcaaga tgctgcggct ggcggccgac       720
     ggcgtgacca gcttttcgac ggtaccgctg cggctcataa ccaggatagg gttcgtcagc       780
     ctcgcgctgg cgctgctggg catcgtctac gcggtggcgc tgcgggtctt cctgcccgag       840
     gtgaccgtct ccgggtggac gatgctgatg gtcgcgatgc tcttcctggg cggggtgcag       900
     atgctgtcgc tgggggtgat cggctcctac gtcggccgca tctacaacga ggtccagcag       960
     cggccgctct acatcgtccg gaaagtgatc cggtatgacc aggactga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page