(data stored in SCRATCH zone)

EMBL: AM420293.PE18

AM420293.PE18        Location/Qualifiers
FT   CDS_pept        28020..28928
FT                   /transl_table=11
FT                   /locus_tag="SACE_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99373"
FT                   /db_xref="GOA:A4F5P9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P9"
FT                   /protein_id="CAL99373.1"
FT                   /translation="MRGDEPLVRELLAGSGPGRRVVLVHPGALPLSCYRPLAAELSGDT
FT                   SLHVVDLEKVPEYFEAALTDHDTGLSLDGVAERVHRELAAHGLLGDDVVLGGWSFGGVV
FT                   GYAVAARSAPRKRPRRLLVADSIAPVAEFTTTTDDEIGPELLLPWFAMYLGAKRGVAID
FT                   LDAGDVRGMDVEAGLQRALTAVLDAGALPPDTSVAGLRSVYRAYSRGLLRNDRVARDHA
FT                   AKPVDVPITLVRPRSGLLGGSRPLGWDQLAAAGLSTLDCPGDHYSMLSDPDAVAVLADA
FT                   ALERGGSRAPAPSRTTGRQPS"
     atgcgggggg atgagccgct ggtccgggag ctgctggccg gcagcggtcc cggccgccgg        60
     gtcgtgctcg tgcaccccgg cgcgctgccg ctgagctgct accggccgct cgcggcggag       120
     ctctccggcg acacctcgct gcacgtggtg gacctggaga aggtcccgga gtacttcgag       180
     gcggcgctga ccgaccacga caccggcctg tcgctggacg gcgtggccga gcgggtccac       240
     cgcgagctgg cggcacacgg cctgctgggc gatgacgttg tcctcggcgg ctggtcgttc       300
     gggggtgtgg tcggctacgc ggtggccgcc aggtcggcgc cgcggaagcg tccgcgccgg       360
     ctgctggtgg ccgacagcat cgccccggtg gccgagttca ccaccacgac cgacgacgag       420
     atcggcccgg agctgctgct gccgtggttc gcgatgtacc tcggcgccaa gcgcggcgtc       480
     gccatcgacc tcgacgccgg cgacgtccgc ggcatggacg tcgaagcggg cctgcagcgc       540
     gcgctcaccg cggtcctcga cgcgggcgcg ctgccgcccg acaccagcgt ggcgggcctg       600
     cgcagcgtct accgcgcgta ctcgcgggga ctcctgcgca acgaccgggt cgcgcgcgac       660
     cacgccgcca agcccgtgga cgtgcccatc acgctggtgc gtccccgctc cgggctgctc       720
     ggcggcagca gaccgctcgg ctgggaccag ctcgcagcag ccggtctgtc cacgttggac       780
     tgccccggcg accactactc gatgctgtcc gatcccgacg ccgtcgcggt cctcgccgac       840
     gccgcgctgg agcgcggcgg ttcccgtgcc cccgccccat cccgcacgac tggcaggcaa       900
     ccgtcatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page