(data stored in ACNUC1104 zone)

EMBL: AM420293.PE186

AM420293.PE186       Location/Qualifiers
FT   CDS_pept        complement(222494..223693)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0189"
FT                   /product="two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99541"
FT                   /db_xref="GOA:A4F667"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F667"
FT                   /protein_id="CAL99541.1"
FT                   /translation="MRVRTKLAVSIAGIAAAASLALGLTVHEVTQRTRQDQARQVLAER
FT                   LELAARAYGDTGSLTLGTRLDDPGLPAPLRTAAHSGQLATYLDEAADGSELWAATSVLG
FT                   RVMSAHTSFESEQAGIRELDRTIMVAGTATVITTTLLAIMIAASLGRRLSTAAATAREV
FT                   AGGALDARTGFSRTRRPRDEVTDLAGALDGMAAALQARIEAEQRVTADIAHDLRTPVAG
FT                   LVTAAELLPPSRGTELVRDRVAVLRTLVEDVLEVARLDADVEVADNDHVSTAELGKRCA
FT                   AASGAELRVLKDAQVSTDPRRVERIVSNLVANGLAHGEPPVVITVDGPVLRVRDRGPGY
FT                   PPELLETGPRRFRTAAPARGRGHGLGLTIATGQAGVLGASLTFANHEDGGAIATLRLPD
FT                   "
     atgcgcgtcc gcacgaaact cgccgtcagc atcgccggaa tcgccgcggc ggccagtctg        60
     gcgctgggcc tgacggtgca cgaggtgacg cagcggacca ggcaggacca ggcgcggcag       120
     gtgctggccg aacggctgga gctcgccgcc cgcgcctacg gcgacacggg ttcgctcacc       180
     ctcggaacgc ggctcgacga tccggggcta cccgcgcctc tgcgaaccgc ggcgcactcg       240
     gggcaactcg ccacgtacct ggacgaagcg gcggacggca gcgagttgtg ggcggcgacc       300
     tcggtgctcg ggcgcgtgat gtcggcgcac acgtcgttcg agtcggagca ggccgggatc       360
     cgcgagctgg accgcaccat catggtcgcg ggcaccgcca ccgtcatcac cacgacactg       420
     ctggccatca tgatcgccgc gagcctgggg cgccggttga gcaccgcggc cgccaccgcg       480
     cgcgaggtcg ccggcggtgc gctcgacgcg aggaccgggt tctcccgcac gcgccggccg       540
     cgcgacgagg tcaccgacct ggccggcgcc ctcgacggga tggccgccgc gctgcaggcc       600
     cgcatcgagg ccgaacagcg ggtgaccgcc gacatcgcgc acgacctgcg caccccggtc       660
     gccggtctgg tcaccgcggc cgagctgctg cctcccagcc gtggcaccga actggtgcgc       720
     gaccgggtcg cggtcctgcg caccctggtc gaggacgtgc tcgaagtcgc ccgcttggac       780
     gccgatgtgg aggtcgccga caacgaccac gtctccaccg cggagttggg gaagcggtgc       840
     gcggccgcca gtggcgcgga gctgcgggtg ctcaaggacg cccaggtcag cacggatccg       900
     cgccgcgtgg aacgaatagt gtcgaatctg gtggccaacg gactggcgca cggcgagccg       960
     ccggtcgtga tcaccgtgga cggtccggtg ctgcgggtgc gcgatcgcgg tccgggctac      1020
     ccgcccgagc tgctcgagac cggcccgcgg cggttccgca ccgccgcacc ggcacggggc      1080
     cggggacacg gcctgggact cacgatcgcg accggccagg cgggcgttct cggtgcgagc      1140
     ctgacgttcg cgaaccacga ggacggcggc gcgatcgcga cgctgcgcct gccggactga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page