(data stored in ACNUC1104 zone)

EMBL: AM420293.PE188

AM420293.PE188       Location/Qualifiers
FT   CDS_pept        224649..225080
FT                   /transl_table=11
FT                   /locus_tag="SACE_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99543"
FT                   /db_xref="UniProtKB/TrEMBL:A4F669"
FT                   /protein_id="CAL99543.1"
FT                   /translation="MRKISLVAAAITVATCTAGGIAWSDETPEPVKLMDRWQHAAEQPG
FT                   NFSITSHDGLQDLKWTRWGQEEAVAHGTLVLNPCEPDCAGAPPQYYPDATLRVDQVREV
FT                   GDGNYYSRYTVTADGLPPEKADQLANQPANLPEDVAVRY"
     atgcgcaaga tctccttggt ggcagccgcg atcacggtcg ccacgtgcac ggcgggcggt        60
     atcgcgtgga gcgacgagac cccggagccg gtcaagctga tggacaggtg gcagcacgcg       120
     gccgagcagc ccgggaactt ctccatcacc tcccacgacg gtctccagga cctgaagtgg       180
     acccggtggg ggcaggaaga ggccgtggca cacggcaccc tggtcctcaa cccgtgcgag       240
     ccggactgcg ccggcgcgcc gccgcagtac taccctgacg cgacgctgcg ggtcgaccag       300
     gtgcgcgagg tcggcgacgg gaactactac agccgctaca cggtgaccgc agacggcctt       360
     ccgcccgaga aggccgacca gctggccaac cagccggcga acctcccgga ggacgtggcc       420
     gtgcggtact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page