(data stored in ACNUC1104 zone)

EMBL: AM420293.PE197

AM420293.PE197       Location/Qualifiers
FT   CDS_pept        complement(234848..235666)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0200"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /function="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99552"
FT                   /db_xref="GOA:A4F678"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F678"
FT                   /protein_id="CAL99552.1"
FT                   /translation="MVSIDVWNAAVDFPIFDAKSRSLKKAVLGKAGGRIGTDSRVPIIE
FT                   ALHDINLSLRHGDRVALVGHNGAGKSTLLRLLAGIYEPTRGSARVVGKVAPVFDLGVGM
FT                   DPEISGYENIIIRGLFLGMNRKQMEARIDEIAEFTELGDYLEMPLRTYSTGMRVRLALG
FT                   VVTSIDPEILILDEGIGAVDADFLEKARDRLNDLVKRSGILVFASHSDEFLIELCNTAL
FT                   WMDKGGIKERGSLRSVLTHYKGHDPFENLSEETLARIGESAASIGSEEGS"
     gtggtcagca tcgacgtttg gaacgcagcc gtcgacttcc cgatcttcga cgcgaagtcg        60
     agatcgctga agaaggccgt gctcggaaag gccggcggca ggatcggcac cgacagccgg       120
     gtcccgatca tcgaggccct gcacgacatc aacctctccc tgcgccacgg tgaccgggtg       180
     gcgctggtcg ggcacaacgg cgcgggcaag tccacgctgc tgcggctgct cgccgggatc       240
     tacgagccga cgcgcggcag cgcccgcgtg gtcggcaagg tcgcgccggt cttcgacctg       300
     ggcgtgggca tggacccgga gatctccggg tacgagaaca tcatcatccg gggtctgttc       360
     ctcgggatga accgcaagca gatggaagcg cggatcgacg agatcgccga gttcacagag       420
     ctgggcgact acctggagat gccgctgcgc acctactcca ccggcatgcg ggtgcggctg       480
     gcgctgggcg tggtcacctc gatcgacccg gagatcctga tcctggacga gggcatcggc       540
     gcggtcgacg ccgacttcct ggagaaggcc cgcgaccggc tcaacgacct ggtcaagcgc       600
     tcgggcatcc tggtgttcgc ctcgcactcc gacgagttcc tcatcgagct gtgcaacacc       660
     gcgctctgga tggacaaggg cggcatcaag gaacggggct cgttgcgcag tgtgctgacg       720
     cactacaagg ggcacgaccc cttcgagaat ctgagcgagg aaaccctggc ccggatcggc       780
     gagtccgcgg cctcgatcgg gagcgaagag ggctcatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page