(data stored in ACNUC1104 zone)

EMBL: AM420293.PE204

AM420293.PE204       Location/Qualifiers
FT   CDS_pept        complement(243674..244657)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0207"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /function="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99559"
FT                   /db_xref="GOA:A4F685"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F685"
FT                   /protein_id="CAL99559.1"
FT                   /translation="MTSAVEVVDLVKRYPKSASNAVDGLSFEVSPGEVFGLLGPNGAGK
FT                   TTTVGILTTRVLLTSGTARVAGIDVAADPVAARGKVAVVPQRVNLDRSLNARQNLVWHA
FT                   NYHGVGRSERHRLADELLERMGLSGKAKARVDDLSGGQAQRLMIARALIHRPEVLFLDE
FT                   PSTGLDPQARLFVHDRVTELRADGVTVVLTTHDMDEAEKLSDRVGIVDHGKLLTLDTPE
FT                   KLIKSLPGSGTLAVTVLSAGVDEHELSELLCAVRGVERVESVSAGQTAEAEPELRLRLY
FT                   VEGEPSALLGPVAQALHQRQVPIIDLSPGSATLEDVFIELTGRELR"
     gtgacgtctg cggttgaagt ggtcgacctg gtcaagaggt acccgaagag cgcgtccaac        60
     gccgtcgacg ggctgagctt cgaggtcagc cccggcgagg tgttcggact gctgggaccg       120
     aacggcgcgg gcaagaccac caccgtcggg atcctcacca cccgggtcct gctgaccagc       180
     ggtaccgcgc gggtcgccgg gatcgacgtc gccgccgacc cggtcgccgc ccgcggcaag       240
     gtcgccgtgg tcccgcagcg ggtcaacctc gaccgctcgc tcaacgcccg gcagaacctg       300
     gtctggcacg ccaactacca cggcgtcggc aggtccgagc gccaccggct cgccgacgag       360
     ctgctggagc ggatgggcct gtcgggcaag gcgaaggcca gggtcgacga cctctccggc       420
     ggccaggccc agcggctgat gatcgcccgc gcgctgatcc accgtcccga ggtgctgttc       480
     ctcgacgaac cgtcgaccgg gctggacccg caggcccgcc tgttcgtcca cgaccgcgtc       540
     accgagctgc gcgccgacgg cgtgacggtg gtgctgacca cgcacgacat ggacgaggcg       600
     gagaagctct ccgaccgcgt cggcatcgtc gaccacggca agctgctcac gctcgacacg       660
     ccggagaagc tgatcaagtc gctgcccggc agcggcaccc tcgccgtgac ggtcctgtcg       720
     gccggtgtcg acgagcacga gctgtccgag ctgctgtgcg cggtgcgcgg ggtcgagcgg       780
     gtggagtcgg tcagcgccgg ccagaccgcc gaggccgagc cggagctgcg actgcggctc       840
     tacgtcgagg gcgagccgtc ggcgttgctg gggccggtcg cacaggccct gcaccagcgg       900
     caggttccga tcatcgacct gtcaccggga tcggcgacgc tggaagacgt gttcatcgaa       960
     ctcaccggga gagaactgcg atga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page