(data stored in ACNUC1104 zone)

EMBL: AM420293.PE207

AM420293.PE207       Location/Qualifiers
FT   CDS_pept        complement(246108..246566)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99562"
FT                   /db_xref="UniProtKB/TrEMBL:A4F688"
FT                   /protein_id="CAL99562.1"
FT                   /translation="MTAFLHTPVKALRCASSPQREHPPLATTRPRPLLAADPRRRTTVL
FT                   LVFPPHGQQPRIDLRPAHLRTFLFDGVGHAPRLVPVQAPRLSRAQVLTFGGRRSSAAGS
FT                   AARQIRTPLLHFGHTRRPPTRHPVDLDVRHGERVRGVRSMAFAPLGHR"
     atgaccgcgt tcttgcacac gccggtgaaa gcactccggt gtgcttcgtc cccgcagcga        60
     gaacatccac cgctggcgac tacacgcccc cgaccccttc tcgcagcaga cccgcgcagg       120
     aggaccaccg tgcttctagt cttcccgcca catggccaac agccacgcat agatctccgg       180
     ccggctcatc tccggacgtt cctcttcgac ggcgtcggtc acgcgcctcg cctcgtcccg       240
     gttcaggccc cgcgactgag ccgcgcgcaa gtactcacgt tcggcggccg acggtcgtcc       300
     gccgccggct ccgcggcccg gcagatccgc acgccattgc tccacttcgg acacacgcgc       360
     cggccgccaa cccggcaccc cgtcgatctc gacgtccggc acggggaacg ggtgcgagga       420
     gtccggtcca tggcgttcgc gccacttggc caccgctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page